Advanced Search (OLGA)

Gene: Pitx3 (paired-like homeodomain 3) Rattus norvegicus

Analyze

Symbol:

Pitx3

Name:

paired-like homeodomain 3

RGD ID:

3332

Description:

Enables DNA-binding transcription factor activity. Involved in several processes, including cellular response to glial cell derived neurotrophic factor; positive regulation of cell proliferation in midbrain; and response to methamphetamine hydrochloride. Located in chromatin. Human ortholog(s) of this gene implicated in anterior segment dysgenesis; anterior segment dysgenesis 1; cataract; cataract 11 multiple types; and cataract 9 multiple types. Orthologous to human PITX3 (paired like homeodomain 3); INTERACTS WITH 17beta-estradiol 3-benzoate; 5-azacytidine; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

homeobox protein PITX3; homeobox protein PTX3; paired-like homeodomain transcription factor 3; pituitary homeobox 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PITX3 (paired like homeodomain 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	Pitx3 (paired-like homeodomain transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pitx3 (paired like homeodomain 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PITX3 (paired like homeodomain 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PITX3 (paired like homeodomain 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pitx3 (paired like homeodomain 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PITX3 (paired like homeodomain 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PITX3 (paired like homeodomain 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pitx3 (paired like homeodomain 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pitx3 (paired like homeodomain 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PITX3 (paired like homeodomain 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pitx3 (paired-like homeodomain transcription factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pitx3 (paired-like homeodomain 3)	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	pitx3 (paired-like homeodomain 3)	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Ptx1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ptx1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-30	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-30	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pitx3	Alliance	DIOPT (PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	254,942,550 - 254,955,325 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	254,942,608 - 254,955,336 (-)	Ensembl				GRCr8
mRatBN7.2	1	245,001,106 - 245,013,881 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	245,001,164 - 245,013,892 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	253,122,834 - 253,135,529 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	259,817,740 - 259,830,442 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	252,469,560 - 252,482,261 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	265,886,766 - 265,899,947 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	265,887,230 - 265,899,958 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	273,317,125 - 273,330,306 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	251,355,785 - 251,368,502 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	240,784,495 - 240,797,213 (-)	NCBI		Celera
RGSC_v3.1	1	251,616,353 - 251,629,068 (-)	NCBI
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anterior segment dysgenesis (ISO,ISS)

anterior segment dysgenesis 1 (ISO)

Aphakia (ISO)

cataract (ISO)

cataract 11 multiple types (ISO)

cataract 9 multiple types (ISO)

genetic disease (ISO)

microphthalmia (ISO)

Neoplasm Recurrence, Local (ISO)

Neurologic Manifestations (ISO)

Parkinson's disease (ISO,ISS)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-azacytidine (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cocaine (ISO)

crocidolite asbestos (ISO)

diazinon (ISO)

dibutyl phthalate (EXP)

dichloroacetic acid (ISO)

folic acid (ISO)

genistein (ISO)

lipopolysaccharide (ISO)

methamphetamine (EXP)

mono(2-ethylhexyl) phthalate (ISO)

N-methyl-4-phenylpyridinium (EXP)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SCH 23390 (EXP)

simazine (ISO)

streptozocin (ISO)

sulforaphane (ISO)

tamoxifen (ISO)

tetrachloroethene (ISO)

titanium dioxide (ISO)

tributylstannane (ISO)

trichloroethene (EXP,ISO)

triclosan (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure morphogenesis (IBA)

cellular response to glial cell derived neurotrophic factor (IEP)

DNA-templated transcription (IEA)

dopaminergic neuron differentiation (IEA,ISO,ISS)

lens development in camera-type eye (IEA,ISO,ISS)

lens fiber cell differentiation (IEA,ISO)

lens morphogenesis in camera-type eye (IEA,ISO,ISS)

locomotory behavior (ISO)

midbrain development (ISO,ISS)

negative regulation of gliogenesis (IDA)

negative regulation of neurogenesis (IDA)

neuron development (ISO)

positive regulation of cell proliferation in midbrain (IDA)

positive regulation of DNA-templated transcription (IEA,ISO,ISS)

positive regulation of neuron apoptotic process (IDA)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA,ISO,ISS)

regulation of gene expression (ISO)

regulation of transcription by RNA polymerase II (IBA)

response to cocaine (IEP)

response to immobilization stress (IEP)

response to methamphetamine hydrochloride (IEP)

Cellular Component

chromatin (IDA)

nucleus (IBA,IEA,ISO,ISS)

Molecular Function

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IDA,IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Posterior polar cataract is the predominant consequence of a recurrent mutation in the PITX3 gene.	Addison PK, etal., Br J Ophthalmol. 2005 Feb;89(2):138-41.
2.	Impaired learning and memory in Pitx3 deficient aphakia mice: a genetic model for striatum-dependent cognitive symptoms in Parkinson's disease.	Ardayfio P, etal., Neurobiol Dis. 2008 Sep;31(3):406-12. doi: 10.1016/j.nbd.2008.05.017. Epub 2008 Jun 4.
3.	Heterozygous and homozygous mutations in PITX3 in a large Lebanese family with posterior polar cataracts and neurodevelopmental abnormalities.	Bidinost C, etal., Invest Ophthalmol Vis Sci. 2006 Apr;47(4):1274-80.
4.	A response element for the homeodomain transcription factor Ptx3 in the tyrosine hydroxylase gene promoter.	Cazorla P, etal., J Neurochem. 2000 May;74(5):1829-37.
5.	Morphine administration modulates expression of Argonaute 2 and dopamine-related transcription factors involved in midbrain dopaminergic neurons function.	Garcia-Perez D, etal., Br J Pharmacol. 2013 Apr;168(8):1889-901. doi: 10.1111/bph.12083.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Valproate increases dopamine transporter expression through histone acetylation and enhanced promoter binding of Nurr1.	Green AL, etal., Neuropharmacology. 2017 Oct;125:189-196. doi: 10.1016/j.neuropharm.2017.07.020. Epub 2017 Jul 22.
9.	Immunocytochemical expression of dopamine-related transcription factors Pitx3 and Nurr1 in prenatally stressed adult rats.	Katunar MR, etal., J Neurosci Res. 2009 Mar;87(4):1014-22. doi: 10.1002/jnr.21911.
10.	Ontogenetic expression of dopamine-related transcription factors and tyrosine hydroxylase in prenatally stressed rats.	Katunar MR, etal., Neurotox Res. 2010 Jul;18(1):69-81. doi: 10.1007/s12640-009-9132-z. Epub 2009 Nov 20.
11.	Chronic methamphetamine administration causes differential regulation of transcription factors in the rat midbrain.	Krasnova IN, etal., PLoS One. 2011 Apr 25;6(4):e19179. doi: 10.1371/journal.pone.0019179.
12.	Signaling of glial cell line-derived neurotrophic factor and its receptor GFRalpha1 induce Nurr1 and Pitx3 to promote survival of grafted midbrain-derived neural stem cells in a rat model of Parkinson disease.	Lei Z, etal., J Neuropathol Exp Neurol. 2011 Sep;70(9):736-47.
13.	Chronic cocaine administration modulates the expression of transcription factors involved in midbrain dopaminergic neuron function.	Leo D, etal., Exp Neurol. 2007 Feb;203(2):472-80. Epub 2006 Oct 27.
14.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
17.	GOA pipeline	RGD automated data pipeline
18.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	A double-deletion mutation in the Pitx3 gene causes arrested lens development in aphakia mice.	Rieger DK, etal., Genomics. 2001 Feb 15;72(1):61-72.
21.	Effects on differentiation of embryonic ventral midbrain progenitors by Lmx1a, Msx1, Ngn2, and Pitx3.	Roybon L, etal., J Neurosci. 2008 Apr 2;28(14):3644-56. doi: 10.1523/JNEUROSCI.0311-08.2008.
22.	A novel homeobox gene PITX3 is mutated in families with autosomal-dominant cataracts and ASMD.	Semina EV, etal., Nat Genet 1998 Jun;19(2):167-70.
23.	A homeodomain gene Ptx3 has highly restricted brain expression in mesencephalic dopaminergic neurons.	Smidt MP, etal., Proc Natl Acad Sci U S A 1997 Nov 25;94(24):13305-10.
24.	Anterior segment mesenchymal dysgenesis in a large Australian family is associated with the recurrent 17 bp duplication in PITX3.	Summers KM, etal., Mol Vis. 2008;14:2010-5. Epub 2008 Nov 5.
25.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
26.	Expression of truncated PITX3 in the developing lens leads to microphthalmia and aphakia in mice.	Wada K, etal., PLoS One. 2014 Oct 27;9(10):e111432. doi: 10.1371/journal.pone.0111432. eCollection 2014.

Additional References at PubMed

PMID:11299318	PMID:14973278	PMID:15950611	PMID:16190884	PMID:17184956	PMID:17761882	PMID:17919745	PMID:18646205	PMID:19007884	PMID:19144721	PMID:19334279	PMID:19515692
PMID:20175877	PMID:23863478	PMID:30634592

Genomics

Comparative Map Data

Pitx3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	254,942,550 - 254,955,325 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	254,942,608 - 254,955,336 (-)	Ensembl				GRCr8
mRatBN7.2	1	245,001,106 - 245,013,881 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	245,001,164 - 245,013,892 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	253,122,834 - 253,135,529 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	259,817,740 - 259,830,442 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	252,469,560 - 252,482,261 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	265,886,766 - 265,899,947 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	265,887,230 - 265,899,958 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	273,317,125 - 273,330,306 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	251,355,785 - 251,368,502 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	240,784,495 - 240,797,213 (-)	NCBI		Celera
RGSC_v3.1	1	251,616,353 - 251,629,068 (-)	NCBI
Cytogenetic Map	1	q54	NCBI

PITX3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	102,230,189 - 102,241,512 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	102,230,189 - 102,241,512 (-)	Ensembl			hg38	GRCh38
GRCh37	10	103,989,946 - 104,001,269 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	103,979,936 - 103,991,221 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	103,979,935 - 103,991,221	NCBI
Celera	10	97,730,869 - 97,742,153 (-)	NCBI		Celera
Cytogenetic Map	10	q24.32	NCBI
HuRef	10	97,622,237 - 97,633,522 (-)	NCBI		HuRef
CHM1_1	10	104,273,459 - 104,284,755 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	103,115,176 - 103,126,499 (-)	NCBI		T2T-CHM13v2.0

Pitx3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	46,123,720 - 46,136,764 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	46,124,124 - 46,136,765 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	46,135,281 - 46,148,325 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	46,135,685 - 46,148,326 (-)	Ensembl			mm10	GRCm38
MGSCv37	19	46,210,175 - 46,222,815 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	46,188,996 - 46,201,636 (-)	NCBI		MGSCv36	mm8
Celera	19	46,899,486 - 46,912,129 (-)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	38.75	NCBI

Pitx3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955485	8,130,244 - 8,140,292 (+)	Ensembl
ChiLan1.0	NW_004955485	8,130,244 - 8,140,292 (+)	NCBI	ChiLan1.0	ChiLan1.0

PITX3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	114,117,326 - 114,132,913 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	114,122,647 - 114,138,234 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	98,833,330 - 98,846,292 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	102,301,528 - 102,302,943 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

PITX3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	14,760,741 - 14,775,584 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	14,761,094 - 14,762,716 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	14,932,709 - 14,949,677 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	15,234,082 - 15,251,065 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	15,234,605 - 15,248,433 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	14,779,199 - 14,796,402 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	14,818,353 - 14,829,717 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	14,951,115 - 14,968,074 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pitx3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	32,004,580 - 32,016,313 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936600	3,607,819 - 3,620,917 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936600	3,607,883 - 3,619,538 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PITX3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	113,230,965 - 113,241,360 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	113,230,194 - 113,241,393 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	123,084,113 - 123,095,511 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PITX3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	95,266,257 - 95,278,333 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	95,266,582 - 95,268,139 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	56,368,363 - 56,370,376 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pitx3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624831	1,650,381 - 1,651,699 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624831	1,649,585 - 1,651,729 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pitx3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	45,602,006 - 45,614,446 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pitx3
56 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	72
Count of miRNA genes:	59
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000026013
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	238398865	255849249	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228180243	255849249	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

AF005772

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	254,942,586 - 254,942,680 (+)	Marker Load Pipeline
mRatBN7.2	1	245,001,141 - 245,001,236 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	265,887,208 - 265,887,302	NCBI	Rnor6.0
Rnor_5.0	1	273,317,567 - 273,317,661	UniSTS	Rnor5.0
RGSC_v3.4	1	251,355,763 - 251,355,857	UniSTS	RGSC3.4
Celera	1	240,784,473 - 240,784,567	UniSTS
Cytogenetic Map	1	q54	UniSTS

Pitx3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	245,002,596 - 245,002,838 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	265,888,663 - 265,888,904	NCBI	Rnor6.0
Rnor_5.0	1	273,319,022 - 273,319,263	UniSTS	Rnor5.0
RGSC_v3.4	1	251,357,218 - 251,357,459	UniSTS	RGSC3.4
Celera	1	240,785,928 - 240,786,169	UniSTS
Cytogenetic Map	1	q54	UniSTS

RH142219

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	254,942,653 - 254,942,845 (+)	Marker Load Pipeline
mRatBN7.2	1	245,001,209 - 245,001,401 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	265,887,276 - 265,887,467	NCBI	Rnor6.0
Rnor_5.0	1	273,317,635 - 273,317,826	UniSTS	Rnor5.0
RGSC_v3.4	1	251,355,831 - 251,356,022	UniSTS	RGSC3.4
Celera	1	240,784,541 - 240,784,732	UniSTS
RH 3.4 Map	9	495.9	UniSTS
Cytogenetic Map	1	q54	UniSTS

D1Bda64

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	254,943,248 - 254,943,938 (+)	Marker Load Pipeline
mRatBN7.2	1	245,001,804 - 245,002,494 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	265,887,871 - 265,888,560	NCBI	Rnor6.0
Rnor_5.0	1	273,318,230 - 273,318,919	UniSTS	Rnor5.0
RGSC_v3.4	1	251,356,426 - 251,357,115	UniSTS	RGSC3.4
Celera	1	240,785,136 - 240,785,825	UniSTS
Cytogenetic Map	1	q54	UniSTS

UniSTS:144187

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	245,001,811 - 245,002,023 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	265,887,878 - 265,888,089	NCBI	Rnor6.0
Rnor_5.0	1	273,318,237 - 273,318,448	UniSTS	Rnor5.0
RGSC_v3.4	1	251,356,433 - 251,356,644	UniSTS	RGSC3.4
Celera	1	240,785,143 - 240,785,354	UniSTS
Cytogenetic Map	1	q54	UniSTS

UniSTS:256827

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	254,943,209 - 254,943,920 (+)	Marker Load Pipeline
mRatBN7.2	1	245,001,765 - 245,002,476 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	265,887,832 - 265,888,542	NCBI	Rnor6.0
Rnor_5.0	1	273,318,191 - 273,318,901	UniSTS	Rnor5.0
RGSC_v3.4	1	251,356,387 - 251,357,097	UniSTS	RGSC3.4
Celera	1	240,785,097 - 240,785,807	UniSTS
Cytogenetic Map	1	q54	UniSTS

Pitx3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	245,001,811 - 245,002,022 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	265,887,878 - 265,888,088	NCBI	Rnor6.0
Rnor_5.0	1	273,318,237 - 273,318,447	UniSTS	Rnor5.0
RGSC_v3.4	1	251,356,433 - 251,356,643	UniSTS	RGSC3.4
Celera	1	240,785,143 - 240,785,353	UniSTS
Cytogenetic Map	1	q54	UniSTS

Pitx3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	245,001,507 - 245,002,845 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	265,887,574 - 265,888,911	NCBI	Rnor6.0
Rnor_5.0	1	273,317,933 - 273,319,270	UniSTS	Rnor5.0
Celera	1	240,784,839 - 240,786,176	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	11	42	87	31	30	15	1	15	6	137	66	8	67	37	61	15	5	5

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019247	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006231478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ011005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026013 ⟹ ENSRNOP00000026013

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	254,942,608 - 254,955,336 (-)	Ensembl
mRatBN7.2 Ensembl	1	245,001,164 - 245,013,892 (-)	Ensembl
Rnor_6.0 Ensembl	1	265,887,230 - 265,899,958 (-)	Ensembl

RefSeq Acc Id:

NM_019247 ⟹ NP_062120

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	254,942,608 - 254,955,325 (-)	NCBI
mRatBN7.2	1	245,001,164 - 245,013,881 (-)	NCBI
Rnor_6.0	1	265,887,230 - 265,899,947 (-)	NCBI
Rnor_5.0	1	273,317,125 - 273,330,306 (-)	NCBI
RGSC_v3.4	1	251,355,785 - 251,368,502 (-)	RGD
Celera	1	240,784,495 - 240,797,213 (-)	RGD

Sequence:

show sequence

GAATTCGGGCCCCCAGCCACCACCGGGAGTCTGCCTGCTGCGGGACACACTAGCCCTCCCTCCA
TGGAGTTTGGGCTGCTTGGTGAGGCAGAGGCTCGAAGCCCTGCGCTGTCATTGTCAGATGCAGG
CACTCCACACCCTCCGCTTCCAGAACATGGCTGCAAGGGGCAGGAGCACAGTGACTCGGAGAAG
GCCTCGGCCTCACTGCCGGGGGGCTCCCCTGAGGATGGCTCCCTGAAGAAGAAGCAGCGGCGGC
AGCGCACGCACTTCACCAGCCAGCAGCTGCAGGAGCTGGAGGCCACCTTCCAGAGGAATCGCTA
CCCCGACATGAGCACGCGCGAAGAGATCGCCGTGTGGACCAACCTCACTGAGGCCCGCGTGCGG
GTGTGGTTCAAGAACCGGCGCGCCAAGTGGCGGAAGCGGGAGCGCAGCCAGCAGGCGGAGCTGT
GCAAGGGCGGCTTCGCAGCCCCGCTCGGGGGCCTGGTGCCACCCTACGAGGAGGTGTACCCGGG
CTACACGTACGGCAACTGGCCGCCCAAGGCGCTCGCCCCGCCGCTCGCCGCCAAGACCTTCCCG
TTCGCCTTCAACTCGGTCAACGTGGGGCCTCTAGCTTCACAACCTGTATTCTCACCGCCCAGCT
CCATCGCTGCCTCCATGGTGCCCTCGGCGGCCGCTGCCCCGGGCACCGTCCCAGGTCCCGGAGC
CTTGCAGGGCCTGGGCGGGGCACCCCCCGGGCTGGCTCCAGCCGCCGTGTCCTCCGGGGCAGTG
TCCTGCCCTTACGCCTCGGCCGCCGCAGCCGCCGCTGCAGCCGCCTCCTCCCCTTATGTATACC
GGGACCCGTGTAACTCGAGCCTGGCTAGCCTGCGGCTCAAAGCCAAGCAGCACGCCTCTTTCAG
CTACCCCGCCGTGCCCGGGCCGCCGCCGGCCGCTAACCTTAGTCCCTGCCAGTACGCCGTGGAA
CGGCCAGTGTGAACCGCAGGTCTGTGGATCCATCCCCGAGGGCGGGGCAGTAATTCACAGCCTC
TCTGGACAGGGGTCGCCTAGACTGGCTTGCCCTTCGTCCCAGGGTCTGAAAAGGGGTGCCAGAG
CACCCGGGAAGAGGCGGCTCCGAAGAGGGCCTTTTCCCTCACAGCCCCTGAGGGGTGGTCTGAC
CCCTATACGGAGACCGCGGCCCTGGGACTAAGGCCAGGAACAGGGACCAGCTCCCCCGGGGCCA
ATTCACCCTTGGCTCACCCCGCCTTCTCCCCGAATTC

hide sequence

RefSeq Acc Id:

XM_006231478 ⟹ XP_006231540

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	254,942,550 - 254,948,262 (-)	NCBI
mRatBN7.2	1	245,001,106 - 245,006,844 (-)	NCBI
Rnor_6.0	1	265,886,766 - 265,892,917 (-)	NCBI
Rnor_5.0	1	273,317,125 - 273,330,306 (-)	NCBI

Sequence:

show sequence

TGTCTGTCTGCCTGGATGTGGGAGCGCATGTGTGGGAGAGTGTGTGTTTTTGTGCCTCTAGCTG
CAAGTCCAAGTGCTCACTGTGTCTAAGTGGAGGCCTGTGTGTGTCTGCACATGTGTCGTCTGTC
TCTGAGAGTGCACAGCTTGAACTCTGCCTGTCTCTTGCTCCGACTGCTATCCTCTTCCCGGGGC
CTCCTTCTACTGAAATAGAGGATGAAATCAAGCCACAGAGCCCTCCCTCCATGGAGTTTGGGCT
GCTTGGTGAGGCAGAGGCTCGAAGCCCTGCGCTGTCATTGTCAGATGCAGGCACTCCACACCCT
CCGCTTCCAGAACATGGCTGCAAGGGGCAGGAGCACAGTGACTCGGAGAAGGCCTCGGCCTCAC
TGCCGGGGGGCTCCCCTGAGGATGGCTCCCTGAAGAAGAAGCAGCGGCGGCAGCGCACGCACTT
CACCAGCCAGCAGCTGCAGGAGCTGGAGGCCACCTTCCAGAGGAATCGCTACCCCGACATGAGC
ACGCGCGAAGAGATCGCCGTGTGGACCAACCTCACTGAGGCCCGCGTGCGGGTGTGGTTCAAGA
ACCGGCGCGCCAAGTGGCGGAAGCGGGAGCGCAGCCAGCAGGCGGAGCTGTGCAAGGGCGGCTT
CGCAGCCCCGCTCGGGGGCCTGGTGCCACCCTACGAGGAGGTGTACCCGGGCTACACGTACGGC
AACTGGCCGCCCAAGGCGCTCGCCCCGCCGCTCGCCGCCAAGACCTTCCCGTTCGCCTTCAACT
CGGTCAACGTGGGGCCTCTGGCTTCACAACCTGTATTCTCACCGCCCAGCTCCATCGCTGCCTC
CATGGTGCCCTCGGCGGCCGCTGCCCCGGGCACCGTCCCAGGTCCCGGAGCCTTGCAGGGCCTG
GGCGGGGCACCCCCCGGGCTGGCTCCAGCCGCCGTGTCCTCCGGGGCAGTGTCCTGCCCTTACG
CCTCGGCCGCCGCAGCCGCCGCTGCAGCCGCCTCCTCCCCTTATGTATACCGGGACCCGTGTAA
CTCGAGCCTGGCTAGCCTGCGGCTCAAAGCCAAGCAGCACGCCTCTTTCAGCTACCCCGCCGTG
CCCGGGCCGCCGCCGGCCGCTAACCTTAGTCCCTGCCAGTACGCCGTGGAACGGCCAGTGTGAA
CCGCAGGTCTGTGGATCCATCCCCGAGGGCGGGGCAGTAATTCACAGCCTCTCTGGACAGGGGT
CGCCTAGACTGGCTTGCCCTCGTCCCAGGGTCTGAAAAGGGGTGCCAGAGCACCCGGGAAGAGG
CGGCTCCGAAGAGGGCCTTTTCCCTCACAGCCCCTGAGGGGTGGTCTGACCCCTATACGGAGAC
CGCGGCCCTGGGACTAAGGCCAGGAACAGGGACCAGCTCCCCCGGGGCCAATTCACCCTTGGCT
CACCCCGCCTTCTCCAGACTCCCCCTATCCCGTTTTCAAAGATCAATGAAATAAACGTGCGCGG
ACTGTCAAAGGCCTGATGATTCAGACTTGCGGTTGAGCCCTCCTTCCCCCCATCCTTCCCATTG
TCCAAAAGGACAGCTGGATGTACGGGAACGGAGTGAGCGTCCAGGCTTCTAAGGCTTCCGTCTC
ACTCCTTTTCTCCAGGATGGGGAAGCAGGGTCTCCTTGGAGTAAAGAATTTACGAAGCTTGGCG
TGACCAGCTAGTTGACAGCGATCGTCCTCTGCTGGTGCTGCGACGCCACCTGGTGGTCTCAGGG
AGGACAGCTGGTAGGCCTGGTCTCCAGCGCTTCCTTGCAGGGATCTGTTTTTGCAGTTTAGCCT
ATGACTTTAGGACTTGTTTCTCACTGTTCTTCTCAGAGGCATGGGTCTCTAACAGCAATAAACT
TCTAGTCTGTGACAGACATTTATTAAGCGCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_062120	(Get FASTA)	NCBI Sequence Viewer
	XP_006231540	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA09455	(Get FASTA)	NCBI Sequence Viewer
	EDL94336	(Get FASTA)	NCBI Sequence Viewer
	EDL94337	(Get FASTA)	NCBI Sequence Viewer
	EDL94338	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026013
	ENSRNOP00000026013.2
GenBank Protein	P81062	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062120 ⟸ NM_019247

- UniProtKB:

P81062 (UniProtKB/Swiss-Prot), A6JHL3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEFGLLGEAEARSPALSLSDAGTPHPPLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRR
QRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAEL
CKGGFAAPLGGLVPPYEEVYPGYTYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPS
SIAASMVPSAAAAPGTVPGPGALQGLGGAPPGLAPAAVSSGAVSCPYASAAAAAAAAASSPYVY
RDPCNSSLASLRLKAKQHASFSYPAVPGPPPAANLSPCQYAVERPV

hide sequence

RefSeq Acc Id:	XP_006231540 ⟸ XM_006231478
- Peptide Label:	isoform X1
- UniProtKB:	P81062 (UniProtKB/Swiss-Prot), A6JHL3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEFGLLGEAEARSPALSLSDAGTPHPPLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRR QRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAEL CKGGFAAPLGGLVPPYEEVYPGYTYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPS SIAASMVPSAAAAPGTVPGPGALQGLGGAPPGLAPAAVSSGAVSCPYASAAAAAAAAASSPYVY RDPCNSSLASLRLKAKQHASFSYPAVPGPPPAANLSPCQYAVERPV hide sequence

Ensembl Acc Id:

ENSRNOP00000026013 ⟸ ENSRNOT00000026013

Protein Domains

Homeobox OAR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P81062-F1-model_v2	AlphaFold	P81062	1-302	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3332	AgrOrtholog
BioCyc Gene	G2FUF-55526	BioCyc
Ensembl Genes	ENSRNOG00000019194	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026013	ENTREZGENE
	ENSRNOT00000026013.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	Homeobox_Pitx/unc30	UniProtKB/Swiss-Prot
	OAR_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:29609	UniProtKB/Swiss-Prot
NCBI Gene	29609	ENTREZGENE
PANTHER	PITUITARY HOMEOBOX 3	UniProtKB/Swiss-Prot
	PITUITARY HOMEOBOX HOMOLOG PTX1	UniProtKB/Swiss-Prot
Pfam	Homeodomain	UniProtKB/Swiss-Prot
	OAR	UniProtKB/Swiss-Prot
PhenoGen	Pitx3	PhenoGen
PIRSF	Homeobox_protein_Pitx/Unc30	UniProtKB/Swiss-Prot
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
	OAR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019194	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
TIGR	TC218469
UniProt	A6JHL3	ENTREZGENE, UniProtKB/TrEMBL
	A6JHL4_RAT	UniProtKB/TrEMBL
	P81062	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-09	Pitx3	paired-like homeodomain 3	Pitx3	paired-like homeodomain transcription factor 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Pitx3	paired-like homeodomain transcription factor 3			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed specifically in neurons of the mesencephalic dopaminergic (mesDA) system	69932

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM