Advanced Search (OLGA)

Gene: Neurog1 (neurogenin 1) Rattus norvegicus

Analyze

Symbol:

Neurog1

Name:

neurogenin 1

RGD ID:

3167

Description:

Predicted to enable several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; E-box binding activity; and protein homodimerization activity. Predicted to be involved in several processes, including cochlea morphogenesis; nervous system development; and regulation of DNA-templated transcription. Predicted to act upstream of or within several processes, including inner ear morphogenesis; positive regulation of exit from mitosis; and regulation of neuron differentiation. Predicted to be located in perikaryon. Predicted to be active in nucleus. Orthologous to human NEUROG1 (neurogenin 1); INTERACTS WITH ammonium chloride; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Neurod3; neurogenic basic-helix-loop-helix protein; neurogenic differentiation 3; neurogenic differentiation factor 3; neurogenin; neurogenin-1; NGN-1; Ngn1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NEUROG1 (neurogenin 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Neurog1 (neurogenin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Neurog1 (neurogenin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NEUROG1 (neurogenin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NEUROG1 (neurogenin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Neurog1 (neurogenin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NEUROG1 (neurogenin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NEUROG1 (neurogenin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Neurog1 (neurogenin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Neurog1 (neurogenin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NEUROG1 (neurogenin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Neurog1 (neurogenin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	neurog1 (neurogenin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ngn-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ngn-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	tap	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	neurog1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	neurog1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	8,368,096 - 8,369,615 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	8,368,096 - 8,369,615 (+)	Ensembl				GRCr8
mRatBN7.2	17	8,362,878 - 8,364,397 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	8,362,821 - 8,364,571 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	8,378,967 - 8,380,486 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	9,912,079 - 9,913,599 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	8,375,358 - 8,376,877 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	9,154,656 - 9,156,175 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	9,154,656 - 9,156,175 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	11,315,715 - 11,317,234 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	14,332,636 - 14,334,155 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	8,450,050 - 8,451,569 (+)	NCBI		Celera
RGSC_v3.1	17	14,332,635 - 14,334,155 (+)	NCBI
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

CRANIAL DYSINNERVATION DISORDER, CONGENITAL, WITH ABSENT CORNEAL REFLEX AND DEVELOPMENTAL DELAY (ISO)

Hereditary Neoplastic Syndromes (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane (ISO)

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bucladesine (ISO)

cadmium dichloride (EXP,ISO)

carbamazepine (ISO)

curcumin (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dicyclanil (ISO)

genistein (ISO)

lead diacetate (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

methylmercury chloride (ISO)

paracetamol (ISO)

paraquat (ISO)

resveratrol (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

sorafenib (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

auditory behavior (IEA,ISO)

axon development (IBA)

cell differentiation (IEA)

cell fate commitment (ISO)

cochlea development (IEA,ISO)

cochlea morphogenesis (IEA,ISO)

craniofacial suture morphogenesis (IEA,ISO)

DNA-templated transcription (IEA)

forebrain development (IBA)

genitalia development (IEA,ISO)

genitalia morphogenesis (IEA,ISO)

hard palate morphogenesis (IEA,ISO)

inner ear development (IEA,ISO)

inner ear morphogenesis (IEA,ISO)

learned vocalization behavior (IEA,ISO)

mastication (IEA,ISO)

negative regulation of relaxation of muscle (IEA,ISO)

negative regulation of saliva secretion (IEA,ISO)

nervous system development (IEA,NAS)

neurogenesis (ISO)

neuromuscular process controlling balance (IEA,ISO)

neuron differentiation (ISO)

obsolete positive regulation of DNA-binding transcription factor activity (ISO)

peristalsis (IEA,ISO)

positive regulation of exit from mitosis (ISO)

positive regulation of neuron differentiation (IEA,ISO,ISS)

positive regulation of transcription by RNA polymerase II (IBA,IEA,ISO,ISS)

regulation of muscle organ development (IEA,ISO)

regulation of neuron differentiation (ISO)

sensory organ development (IBA)

thorax and anterior abdomen determination (IEA,ISO)

trigeminal nerve development (IEA,ISO)

vestibulocochlear nerve formation (IEA,ISO)

Cellular Component

neuronal cell body (IEA,ISO)

nucleus (IBA,IEA)

perikaryon (IEA,ISO)

Molecular Function

chromatin binding (IEA,ISO,ISS)

DNA binding (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

E-box binding (IBA,IEA,ISO,ISS)

protein binding (ISO)

protein dimerization activity (IEA)

protein homodimerization activity (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Comparison of the generic neuronal differentiation and neuron subtype specification functions of mammalian achaete-scute and atonal homologs in cultured neural progenitor cells.	Lo L, etal., Development 2002 Apr;129(7):1553-67.
4.	Identification of neurogenin, a vertebrate neuronal determination gene.	Ma Q, etal., Cell 1996 Oct 4;87(1):43-52.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:8889548	PMID:10648228	PMID:14697366	PMID:15065125	PMID:15229646	PMID:16136056	PMID:16145671	PMID:18007592	PMID:18184563	PMID:19365559	PMID:20102160	PMID:20886368
PMID:21645559	PMID:22513373	PMID:23288605	PMID:23419067	PMID:23434913	PMID:27573468

Genomics

Comparative Map Data

Neurog1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	8,368,096 - 8,369,615 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	8,368,096 - 8,369,615 (+)	Ensembl				GRCr8
mRatBN7.2	17	8,362,878 - 8,364,397 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	8,362,821 - 8,364,571 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	8,378,967 - 8,380,486 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	9,912,079 - 9,913,599 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	8,375,358 - 8,376,877 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	9,154,656 - 9,156,175 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	9,154,656 - 9,156,175 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	11,315,715 - 11,317,234 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	14,332,636 - 14,334,155 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	8,450,050 - 8,451,569 (+)	NCBI		Celera
RGSC_v3.1	17	14,332,635 - 14,334,155 (+)	NCBI
Cytogenetic Map	17	p14	NCBI

NEUROG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	135,534,282 - 135,535,964 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	135,534,282 - 135,535,964 (-)	Ensembl			hg38	GRCh38
GRCh37	5	134,869,972 - 134,871,654 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	134,897,871 - 134,899,538 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	134,897,872 - 134,899,538	NCBI
Celera	5	130,993,709 - 130,995,376 (-)	NCBI		Celera
Cytogenetic Map	5	q31.1	NCBI
HuRef	5	130,057,578 - 130,059,245 (-)	NCBI		HuRef
CHM1_1	5	134,302,579 - 134,304,246 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	136,061,404 - 136,063,086 (-)	NCBI		T2T-CHM13v2.0

Neurog1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	56,398,291 - 56,399,993 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	56,398,291 - 56,399,976 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	56,250,478 - 56,252,180 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	56,250,478 - 56,252,163 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	56,351,853 - 56,353,524 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	56,260,114 - 56,261,785 (-)	NCBI		MGSCv36	mm8
Celera	13	57,309,341 - 57,311,011 (-)	NCBI		Celera
Cytogenetic Map	13	B1	NCBI
cM Map	13	30.06	NCBI

Neurog1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	30,694,496 - 30,695,221 (-)	Ensembl
ChiLan1.0	NW_004955408	30,693,893 - 30,695,453 (-)	NCBI	ChiLan1.0	ChiLan1.0

NEUROG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	130,817,937 - 130,819,819 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	128,957,497 - 128,959,379 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	130,922,727 - 130,924,403 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	137,063,644 - 137,065,317 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	137,064,339 - 137,065,052 (-)	Ensembl			panPan2	panpan1.1

NEUROG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	23,563,128 - 23,564,819 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	23,563,803 - 23,564,543 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	22,312,360 - 22,313,631 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	24,380,274 - 24,381,545 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	24,380,805 - 24,381,545 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	23,068,344 - 23,069,618 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	22,934,051 - 22,935,328 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	23,584,107 - 23,585,387 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Neurog1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	123,683,081 - 123,684,853 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936597	2,708,691 - 2,709,425 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936597	2,708,001 - 2,709,702 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NEUROG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	137,765,942 - 137,766,682 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	137,763,091 - 137,766,787 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	143,226,166 - 143,226,906 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NEUROG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	38,318,432 - 38,320,099 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	38,319,121 - 38,319,834 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666034	39,595,891 - 39,597,717 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Neurog1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	11,498,249 - 11,498,974 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624733	11,497,872 - 11,499,957 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Neurog1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	81,828,153 - 81,829,668 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Neurog1
2 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	241
Count of miRNA genes:	158
Interacting mature miRNAs:	184
Transcripts:	ENSRNOT00000015916
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	1	36045694	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	43999106	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4360057	27233623	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	1	21499218	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2120843	42054133	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4733534	49733534	Rat
1581553	Pur14	Proteinuria QTL 14	5.3	0.0001	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	17	7985243	16523460	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	6221998	58177198	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	38037084	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31706603	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4733534	49733534	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	43999106	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4360057	27233623	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	43999106	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2120843	22087569	Rat
1549900	Iddm20	Insulin dependent diabetes mellitus QTL 20	3.7		pancreas integrity trait (VT:0010560)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	17	1	22181410	Rat
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22877318	Rat

Markers in Region

UniSTS:265421

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	8,363,143 - 8,363,549 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	9,154,922 - 9,155,327	NCBI	Rnor6.0
Rnor_5.0	17	11,315,981 - 11,316,386	UniSTS	Rnor5.0
RGSC_v3.4	17	14,332,902 - 14,333,307	UniSTS	RGSC3.4
Celera	17	8,450,316 - 8,450,721	UniSTS
Cytogenetic Map	17	p14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	reproductive system
1	1	1	68	4	4	4	1	4	8	2	69	28

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U67777	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015916 ⟹ ENSRNOP00000015916

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	8,368,096 - 8,369,615 (+)	Ensembl
mRatBN7.2 Ensembl	17	8,362,821 - 8,364,571 (+)	Ensembl
Rnor_6.0 Ensembl	17	9,154,656 - 9,156,175 (+)	Ensembl

RefSeq Acc Id:

NM_019207 ⟹ NP_062080

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	8,368,096 - 8,369,615 (+)	NCBI
mRatBN7.2	17	8,362,878 - 8,364,397 (+)	NCBI
Rnor_6.0	17	9,154,656 - 9,156,175 (+)	NCBI
Rnor_5.0	17	11,315,715 - 11,317,234 (+)	NCBI
RGSC_v3.4	17	14,332,636 - 14,334,155 (+)	RGD
Celera	17	8,450,050 - 8,451,569 (+)	RGD

Sequence:

show sequence

ATCCGGAGCTGATCTGATCGCCGGCGACATCAGTCGGGAGACCAGCCCGGCGCGTGGCCCCCTG
CAGGCGAGGCGAGGAGGCCAAGCCCATTCCCTCCCTGAGCCCCTGCGATCTTCCCCGGCCCTCG
CGCCTGCAGCAGGCACAGGCTAGCCCCGGGTCATACGGACAGTAAGTGCGCTTCGAAGGCCGTG
CACTCGGCCCACATTCAAGCCCTCCAAACCTCCCGTCCGTCCGTCCGTCCTGCAACGATGCCTG
CCCCTTTGGAGACCTGTCTCTCTGACCTCGACTGCGCCAGCAGCAACAGCGGGAGCGACCTGTC
CAGTTTCCTCACCGACGAGGAGGACTGTGCCAGGCTCCAGCCCCTAGCTTCCACCTCAGGGCTG
TCCGTGCCAGCCCGCAGGAGCGCGCCCACCCTCTCCGGGGCATCGAACGTTCCCGGTGGCCAGG
ACGAAGAGCAGGAGCGGCGGCGACGGCGAGGTCGCGCGCGGGTGCGGTCCGAGGCGCTGCTGCA
CTCGCTGCGGAGGAGCCGTCGCGTCAAGGCCAACGATCGCGAGCGCAACCGTATGCATAACCTC
AACGCTGCGCTGGACGCTCTGCGCAGCGTGCTGCCCTCGTTCCCCGACGACACCAAGCTCACCA
AGATTGAGACGCTGCGCTTCGCCTACAACTACATCTGGGCCCTGGCTGAGACACTGCGCCTGGC
AGATCAAGGGCTCCCGGGGGGCGGTGCCCGGGAGCGCCTCCTGCCTCCGCAGTGTGTCCCCTGC
CTGCCCGGTCCCCCGAGCCCGGCCAGCGATACAGAGTCCTGGGGCTCCGGGGCCGCTGCCTCCC
CCTGCGCTACTGTGGCGTCACCACTCTCTGACCCCAGTAGTCCCTCGGCTTCAGAAGACTTCAC
CTATGGCCCGGGTGGTCCCCTTTTCTCCTTTCCTGGCCTGCCCAAAGACCTCCTCCATACGACA
CCCTGCTTCATCCCGTACCACTAGGGCTTTGCAAGACAACGTTAATACTTCTTTCCTGCCCCAG
TCTATGAGCAATAGATGGGGGAGCCGGCTGAAGCCTCGGGGAGCACCCTTACCCCCAGGTGGAT
GCTGGGAGCTTTAAAGAGGGGAGGGATACCTGACCACTTGCTAGGTTGCCGCACCCTCGCTGAG
AAGCTGCCCCTCGGACTGTTTCCCCACGCCCCAGCACCGGGCCCCTCCTGCCCGCCCCCCAGAC
GGGCTTTCGGTTTTTTTTTTGGACTTCCTGAACTTCACAAAACCTCCTTTGTGACTGGCTCAGA
ACTGACCCCAGCCACCACTTCAGTGTGATTTGGAAAAGGGACAGATGAGCCCCTGAAGACGAGG
TGAAAAGTCAATTTTACAATTTGTAGAACTCTAATGAAGAAAAACGAGCATGAAAATTCGGTTT
GAGCCGGCTGACAATACAATGAAAAGGCTTAAAAAAAAGGAGACACAAGGAGTGGGCTTCATGC
ATTATGGATCCCGACCCCCACCACTGTGGGCTTGCTCCCGGAAGAACTGAGTGCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_062080	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52857	(Get FASTA)	NCBI Sequence Viewer
	EDL93943	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015916
	ENSRNOP00000015916.2
GenBank Protein	P70595	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062080 ⟸ NM_019207

- UniProtKB:

P70595 (UniProtKB/Swiss-Prot), A6KAN5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPAPLETCLSDLDCASSNSGSDLSSFLTDEEDCARLQPLASTSGLSVPARRSAPTLSGASNVPG
GQDEEQERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTK
LTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDTESWGSGAA
ASPCATVASPLSDPSSPSASEDFTYGPGGPLFSFPGLPKDLLHTTPCFIPYH

hide sequence

Ensembl Acc Id:

ENSRNOP00000015916 ⟸ ENSRNOT00000015916

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70595-F1-model_v2	AlphaFold	P70595	1-244	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3167	AgrOrtholog
BioCyc Gene	G2FUF-10251	BioCyc
Ensembl Genes	ENSRNOG00000022405	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015916	ENTREZGENE
	ENSRNOT00000015916.4	UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot
InterPro	bHLH_dom	UniProtKB/Swiss-Prot
	bHLH_transcription_factors	UniProtKB/Swiss-Prot
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:29410	UniProtKB/Swiss-Prot
NCBI Gene	29410	ENTREZGENE
PANTHER	BASIC HELIX-LOOP-HELIX PROTEIN NEUROGENIN-RELATED	UniProtKB/Swiss-Prot
	PTHR19290:SF130	UniProtKB/Swiss-Prot
Pfam	HLH	UniProtKB/Swiss-Prot
PhenoGen	Neurog1	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000022405	RatGTEx
SMART	HLH	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot
TIGR	TC236421
UniProt	A6KAN5	ENTREZGENE, UniProtKB/TrEMBL
	NGN1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-15	Neurog1	neurogenin 1	Neurod3	neurogenic differentiation 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Neurod3	neurogenic differentiation 3			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains a basic helix-loop-helix domain	69904

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM