Advanced Search (OLGA)

Gene: Mtrf1l (mitochondrial translation release factor 1 like) Rattus norvegicus

Analyze

Symbol:

Mtrf1l

Name:

mitochondrial translation release factor 1 like

RGD ID:

1598312

Description:

Predicted to enable translation release factor activity, codon specific. Predicted to be involved in mitochondrial translational termination. Predicted to be located in cytoplasm. Predicted to be active in mitochondrion. Orthologous to human MTRF1L (mitochondrial translation release factor 1 like); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC361473; MGC116100; mitochondrial translational release factor 1-like; peptide chain release factor 1-like, mitochondrial; similar to mitochondrial translational release factor 1-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	44,614,162 - 44,626,367 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	44,615,921 - 44,626,178 (-)	Ensembl				GRCr8
mRatBN7.2	1	42,208,553 - 42,221,020 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	42,210,583 - 42,220,836 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	42,752,788 - 42,763,032 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	48,739,981 - 48,750,224 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	42,828,253 - 42,838,496 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	42,475,791 - 42,485,999 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	42,475,792 - 42,486,035 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	43,805,701 - 43,815,909 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	36,506,648 - 36,516,899 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	37,877,868 - 37,888,122 (-)	NCBI		Celera
Cytogenetic Map	1	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

5-aza-2'-deoxycytidine (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsenous acid (ISO)

beauvericin (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bufotalin (ISO)

copper(II) sulfate (ISO)

diarsenic trioxide (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

endosulfan (EXP)

enniatin (ISO)

fenvalerate (EXP)

flutamide (EXP)

furan (EXP)

okadaic acid (ISO)

paracetamol (ISO)

pirinixic acid (EXP)

potassium chromate (ISO)

resveratrol (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

zebularine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mitochondrial translational termination (IBA,IEA,ISO,ISS)

translation (IEA)

translational termination (IEA)

Cellular Component

cytoplasm (IEA)

mitochondrion (IBA,IEA,ISO,ISS)

Molecular Function

translation release factor activity (IEA,ISO,ISS)

translation release factor activity, codon specific (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:18614015

Genomics

Comparative Map Data

Mtrf1l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	44,614,162 - 44,626,367 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	44,615,921 - 44,626,178 (-)	Ensembl				GRCr8
mRatBN7.2	1	42,208,553 - 42,221,020 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	42,210,583 - 42,220,836 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	42,752,788 - 42,763,032 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	48,739,981 - 48,750,224 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	42,828,253 - 42,838,496 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	42,475,791 - 42,485,999 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	42,475,792 - 42,486,035 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	43,805,701 - 43,815,909 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	36,506,648 - 36,516,899 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	37,877,868 - 37,888,122 (-)	NCBI		Celera
Cytogenetic Map	1	q11	NCBI

MTRF1L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	152,987,362 - 153,002,709 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	152,987,362 - 153,002,709 (-)	Ensembl			hg38	GRCh38
GRCh37	6	153,308,497 - 153,323,844 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	153,351,363 - 153,365,540 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	153,401,783 - 153,415,961	NCBI
Celera	6	154,042,070 - 154,057,593 (-)	NCBI		Celera
Cytogenetic Map	6	q25.2	NCBI
HuRef	6	150,871,194 - 150,886,723 (-)	NCBI		HuRef
CHM1_1	6	153,572,324 - 153,587,844 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	154,188,665 - 154,204,007 (-)	NCBI		T2T-CHM13v2.0

Mtrf1l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	5,760,151 - 5,775,015 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	5,761,887 - 5,773,910 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	5,811,119 - 5,825,015 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	5,811,887 - 5,823,910 (-)	Ensembl			mm10	GRCm38
MGSCv37	10	4,522,598 - 4,534,654 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	4,522,631 - 4,533,477 (+)	NCBI		MGSCv36	mm8
Celera	10	5,745,851 - 5,757,938 (-)	NCBI		Celera
Cytogenetic Map	10	A1	NCBI
cM Map	10	1.91	NCBI

Mtrf1l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955439	8,809,617 - 8,823,762 (+)	Ensembl
ChiLan1.0	NW_004955439	8,809,545 - 8,824,442 (+)	NCBI	ChiLan1.0	ChiLan1.0

MTRF1L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	173,017,023 - 173,031,673 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	170,909,381 - 170,924,526 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	150,810,353 - 150,825,162 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	155,498,473 - 155,513,916 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	155,498,473 - 155,513,910 (-)	Ensembl			panPan2	panpan1.1

MTRF1L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	43,155,285 - 43,166,707 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	43,155,419 - 43,166,691 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	43,987,525 - 44,004,328 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	43,333,358 - 43,350,246 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	43,336,148 - 43,350,213 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	43,200,825 - 43,217,696 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	43,064,255 - 43,081,122 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	43,551,975 - 43,568,851 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mtrf1l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	138,351,833 - 138,364,410 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936489	5,606,939 - 5,616,275 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936489	5,606,663 - 5,616,437 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MTRF1L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	13,446,492 - 13,458,287 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	13,443,602 - 13,458,291 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	15,696,595 - 15,708,417 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MTRF1L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	80,471,605 - 80,487,887 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	80,472,958 - 80,487,797 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	52,795,883 - 52,812,748 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mtrf1l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624785	5,226,805 - 5,242,671 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624785	5,226,894 - 5,240,615 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mtrf1l
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	197,046,739 - 197,056,814 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mtrf1l
106 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	9
Count of miRNA genes:	8
Interacting mature miRNAs:	9
Transcripts:	ENSRNOT00000025398
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	43457837	87558729	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	7746118	52746118	Rat
1357397	Bw41	Body weight QTL 41	4.19	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	29409279	74409279	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	43457837	87558729	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	42122968	87122968	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	6941022	51941022	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	6909353	51909353	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	17315378	51816258	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	6909353	51909353	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	6909353	51909353	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	43457837	87558729	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	20508326	65508326	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	30708375	87558729	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	11684464	56684464	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	34565726	79565726	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	7746121	52746121	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	10379492	55379492	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	43509952	88509952	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	42122968	87122968	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	12820494	57820494	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	20656420	65656420	Rat

Markers in Region

RH144048

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	42,222,509 - 42,222,680 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	42,487,651 - 42,487,821	NCBI	Rnor6.0
Rnor_5.0	1	43,817,561 - 43,817,731	UniSTS	Rnor5.0
RGSC_v3.4	1	36,518,575 - 36,518,745	UniSTS	RGSC3.4
Celera	1	37,889,798 - 37,889,968	UniSTS
Cytogenetic Map	1	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025723	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081235	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266098	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025398 ⟹ ENSRNOP00000025398

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	44,615,921 - 44,626,178 (-)	Ensembl
mRatBN7.2 Ensembl	1	42,210,583 - 42,220,836 (-)	Ensembl
Rnor_6.0 Ensembl	1	42,475,792 - 42,486,035 (-)	Ensembl

RefSeq Acc Id:

NM_001025723 ⟹ NP_001020894

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	44,615,921 - 44,626,178 (-)	NCBI
mRatBN7.2	1	42,210,577 - 42,220,834 (-)	NCBI
Rnor_6.0	1	42,475,791 - 42,485,999 (-)	NCBI
Rnor_5.0	1	43,805,701 - 43,815,909 (-)	NCBI
RGSC_v3.4	1	36,506,648 - 36,516,899 (-)	RGD
Celera	1	37,877,868 - 37,888,122 (-)	RGD

Sequence:

show sequence

GCGGCATAGTTCTTCCTGGAGTGTTCTCTGTATGTTTTTGGCTACGGTGGGCGGCTGGGCCAGC
ATGCGGAGCGGGTTTCTGCGCAGTGCCCGGCGCCTGTGGGCCCGCCGCGCCATCAGCCGCATGC
CACCGCCTTCCGAGGAGCTCCTCGCCCGCGGCGGGCCCCTGCGAGCCTTCCTGGAGCGCCGCGT
GGGCTCGGAGGCCGGCGGTCTGGACGCTGGGAGTCCCCAGCTTGCCGCGGCGGCCCGGCTGCTG
AACGAGAAGGAGCGGGAGCTACGGGACACTGAATCCTTGCTGCACGATGAGAATGAAGATTTGA
AGAAACTCGCAGAGAGTGAGATAGCTTTGTGTCAAAAAGAAATAGCCGAGCTGAAGCATCGGAT
CATCTCCCTTTTGGTTCCTTCAGAAGACATGGATGGCAGTGACCTGATCCTGGAGGTGACTGCG
GGTGTGGGTGGTCAGGAAGCCATGCTTTTCACTTCTGAGATGTTTGACATGTACCAGCAATACG
CTGCATTTAAAAGATGGCATTTTGAAACACTGGAATATTTCCCAAGTGAACTAGGTGGCCTCAG
ACATGCATCAGCCAGCATCGGAGGTCCAGAAGCCTACAGACACATGAAATTTGAAGGAGGAGTA
CATAGAGTACAGAGAGTACCAAAGACAGAGAGGCAAGGCCGCATCCACACCAGCACCATGACGG
TGGCAATTCTGCCCCAGCCTACTGAGATTAAACTGGTGATTAACCCTAAAGATTTGAGAATTGA
TACGAAGAGAGCAAGTGGAGCTGGAGGTCAGCACGTAAATACCACAGACAGTGCTGTTCGGATA
GTTCATCTTCCCACAGGTATTATTTCTGAATGCCAGCAAGAAAGATCTCAGCTGAAGAACAGGG
AGCTGGCTATGAAAAAGTTACGTGCAAGGTTATACAGCATGCGTCTAGAGGAAGAAACTGCTAA
AAGATACAGCGCTCGAAAGATCCAGGTTGGAACTAAAGGAAGATCAGAGAAAATAAGAACATAC
AACTTTCCACAAAATAGGGTCACAGATCACAGAATAAACAAATCACTACATGACCTTGAGAGCT
TCATGCAAGGAGACTGTCTTCTGGATGACCTGATACAGTCACTGAAGGACTATTCAGATTATGA
ATCTCTAGTAGAAATGATTTCCAGAAAAGACTAAGCTTCTTTGTAAAGATATATGTTTTTAATA
TACACTGGGAAAATTCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039081235 ⟹ XP_038937163

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	44,614,162 - 44,626,356 (-)	NCBI
mRatBN7.2	1	42,208,818 - 42,221,013 (-)	NCBI

RefSeq Acc Id:

XM_063266088 ⟹ XP_063122158

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	44,620,003 - 44,626,364 (-)	NCBI

RefSeq Acc Id:

XM_063266098 ⟹ XP_063122168

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	44,620,003 - 44,626,367 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020894	(Get FASTA)	NCBI Sequence Viewer
	XP_038937163	(Get FASTA)	NCBI Sequence Viewer
	XP_063122158	(Get FASTA)	NCBI Sequence Viewer
	XP_063122168	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97970	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025398
GenBank Protein	Q4V7E5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001020894 ⟸ NM_001025723
- Peptide Label:	precursor
- UniProtKB:	Q4V7E5 (UniProtKB/Swiss-Prot), A0A8L2QF03 (UniProtKB/TrEMBL), A6KIP0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRSGFLRSARRLWARRAISRMPPPSEELLARGGPLRAFLERRVGSEAGGLDAGSPQLAAAARLL NEKERELRDTESLLHDENEDLKKLAESEIALCQKEIAELKHRIISLLVPSEDMDGSDLILEVTA GVGGQEAMLFTSEMFDMYQQYAAFKRWHFETLEYFPSELGGLRHASASIGGPEAYRHMKFEGGV HRVQRVPKTERQGRIHTSTMTVAILPQPTEIKLVINPKDLRIDTKRASGAGGQHVNTTDSAVRI VHLPTGIISECQQERSQLKNRELAMKKLRARLYSMRLEEETAKRYSARKIQVGTKGRSEKIRTY NFPQNRVTDHRINKSLHDLESFMQGDCLLDDLIQSLKDYSDYESLVEMISRKD hide sequence

Ensembl Acc Id:

ENSRNOP00000025398 ⟸ ENSRNOT00000025398

RefSeq Acc Id:	XP_038937163 ⟸ XM_039081235
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063122168 ⟸ XM_063266098
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063122158 ⟸ XM_063266088
- Peptide Label:	isoform X2

Protein Domains

Prokaryotic-type class I peptide chain release

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V7E5-F1-model_v2	AlphaFold	Q4V7E5	1-373	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1598312	AgrOrtholog
BioCyc Gene	G2FUF-61698	BioCyc
Ensembl Genes	ENSRNOG00000018773	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000025398	ENTREZGENE
Gene3D-CATH	3.30.160.20	UniProtKB/Swiss-Prot
	3.30.70.1660	UniProtKB/Swiss-Prot
	6.10.140.1950	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7442024	IMAGE-MGC_LOAD
InterPro	PCRF	UniProtKB/Swiss-Prot
	Pep_chain_release_fac_I_II	UniProtKB/Swiss-Prot
	Pep_chain_release_fac_I_sf	UniProtKB/Swiss-Prot
	Prokaryotic/Mito_RF	UniProtKB/Swiss-Prot
KEGG Report	rno:361473	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:116100	IMAGE-MGC_LOAD
NCBI Gene	361473	ENTREZGENE
PANTHER	LD18447P	UniProtKB/Swiss-Prot
	PEPTIDE CHAIN RELEASE FACTOR 1-LIKE, MITOCHONDRIAL	UniProtKB/Swiss-Prot
Pfam	PCRF	UniProtKB/Swiss-Prot
	RF-1	UniProtKB/Swiss-Prot
PhenoGen	Mtrf1l	PhenoGen
PROSITE	RF_PROK_I	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018773	RatGTEx
SMART	PCRF	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF75620	UniProtKB/Swiss-Prot
UniProt	A0A8L2QF03	ENTREZGENE, UniProtKB/TrEMBL
	A6KIP0	ENTREZGENE, UniProtKB/TrEMBL
	Q4V7E5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-01-28	Mtrf1l	mitochondrial translation release factor 1 like	Mtrf1l	mitochondrial translational release factor 1-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Mtrf1l	mitochondrial translational release factor 1-like	LOC361473	similar to mitochondrial translational release factor 1-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC361473	similar to mitochondrial translational release factor 1-like			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message