Advanced Search (OLGA)

Gene: Mest (mesoderm specific transcript) Rattus norvegicus

Analyze

Symbol:

Mest

Name:

mesoderm specific transcript

RGD ID:

1594589

Description:

Predicted to enable hydrolase activity. Predicted to be involved in several processes, including generation of neurons; negative regulation of canonical Wnt signaling pathway; and negative regulation of protein glycosylation. Predicted to be located in endoplasmic reticulum membrane. Orthologous to human MEST (mesoderm specific transcript); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3,7-dihydropurine-6-thione.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

mesoderm specific transcript homolog; mesoderm specific transcript homolog (mouse); mesoderm-specific transcript homolog protein; MGC73011

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MEST (mesoderm specific transcript)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Mest (mesoderm specific transcript)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mest (mesoderm specific transcript)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MEST (mesoderm specific transcript)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MEST (mesoderm specific transcript)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mest (mesoderm specific transcript)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MEST (mesoderm specific transcript)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MEST (mesoderm specific transcript)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mest (mesoderm specific transcript)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mest (mesoderm specific transcript)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MEST (mesoderm specific transcript)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mest (mesoderm specific transcript)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mest (mesoderm specific transcript)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mest	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mest	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	60,321,814 - 60,332,288 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	60,316,102 - 60,333,509 (+)	Ensembl				GRCr8
mRatBN7.2	4	59,354,445 - 59,364,919 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	59,354,447 - 59,366,145 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	64,332,471 - 64,342,948 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	60,248,654 - 60,259,132 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	58,650,583 - 58,661,061 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	58,052,786 - 58,063,227 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	58,053,041 - 58,063,138 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	57,811,101 - 57,821,884 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	4	54,452,983 - 54,463,392 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Barth syndrome (ISS)

Childhood Schizophrenia (ISO)

Weight Gain (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,7-dihydropurine-6-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

casticin (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

DDE (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

Didecyldimethylammonium (ISO)

diosgenin (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

fipronil (EXP)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

gentamycin (EXP)

lead diacetate (ISO)

lead(0) (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

mercaptopurine (EXP)

methimazole (EXP)

methoxychlor (ISO)

methyl methanesulfonate (ISO)

mitoxantrone (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (EXP)

nickel sulfate (ISO)

nitrates (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phenformin (EXP)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

purine-6-thiol (EXP)

rimonabant (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

sotorasib (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

topotecan (ISO)

trametinib (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (EXP,ISO)

vinclozolin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

fat cell differentiation (ISO,ISS)

negative regulation of canonical Wnt signaling pathway (ISO,ISS)

negative regulation of glycoprotein biosynthetic process (ISO,ISS)

negative regulation of protein localization to plasma membrane (ISO,ISS)

nervous system development (IEA)

neuron development (ISO,ISS)

radial glia-guided pyramidal neuron migration (ISO,ISS)

regulation of lipid storage (ISO)

regulation of neurogenesis (ISO,ISS)

response to retinoic acid (ISO)

Cellular Component

endoplasmic reticulum (ISO,ISS)

endoplasmic reticulum membrane (IEA,ISO,ISS)

Molecular Function

catalytic activity (IEA)

hydrolase activity (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:18439490	PMID:18644838	PMID:19199708

Genomics

Comparative Map Data

Mest
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	60,321,814 - 60,332,288 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	60,316,102 - 60,333,509 (+)	Ensembl				GRCr8
mRatBN7.2	4	59,354,445 - 59,364,919 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	59,354,447 - 59,366,145 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	64,332,471 - 64,342,948 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	60,248,654 - 60,259,132 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	58,650,583 - 58,661,061 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	58,052,786 - 58,063,227 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	58,053,041 - 58,063,138 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	57,811,101 - 57,821,884 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	4	54,452,983 - 54,463,392 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

MEST
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	130,486,175 - 130,506,465 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	130,486,171 - 130,506,465 (+)	Ensembl			hg38	GRCh38
GRCh37	7	130,126,016 - 130,146,306 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	129,913,282 - 129,933,369 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	129,725,123 - 129,740,080	NCBI
Celera	7	124,921,818 - 124,941,908 (+)	NCBI		Celera
Cytogenetic Map	7	q32.2	NCBI
HuRef	7	124,488,506 - 124,508,626 (+)	NCBI		HuRef
CHM1_1	7	130,059,437 - 130,079,559 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	131,799,896 - 131,820,184 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	129,511,419 - 129,531,544 (+)	NCBI

Mest
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	30,733,505 - 30,783,580 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	30,723,546 - 30,748,464 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	30,733,506 - 30,748,466 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	30,723,547 - 30,748,465 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	30,688,063 - 30,698,457 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	30,688,073 - 30,698,467 (+)	NCBI		MGSCv36	mm8
Celera	6	30,747,989 - 30,758,382 (+)	NCBI		Celera
Cytogenetic Map	6	A3.3	NCBI
cM Map	6	12.53	NCBI

Mest
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	11,122,007 - 11,135,061 (+)	Ensembl
ChiLan1.0	NW_004955479	11,116,705 - 11,135,061 (+)	NCBI	ChiLan1.0	ChiLan1.0

MEST
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	167,305,254 - 167,325,372 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	19,315,515 - 19,335,616 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	122,450,524 - 122,470,855 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	134,968,531 - 134,988,560 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	134,968,638 - 134,988,564 (+)	Ensembl			panPan2	panpan1.1

MEST
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	6,435,693 - 6,454,358 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	6,436,649 - 6,449,099 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	6,125,719 - 6,144,389 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	6,199,967 - 6,218,643 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	6,199,384 - 6,213,400 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	6,405,014 - 6,423,685 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	6,150,268 - 6,168,916 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	6,293,802 - 6,312,481 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mest
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	24,648,250 - 24,668,374 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936579	4,782,756 - 4,800,971 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936579	4,782,761 - 4,800,971 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MEST
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	18,327,536 - 18,345,843 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	18,319,126 - 18,358,655 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	19,327,977 - 19,348,140 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MEST
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	99,121,330 - 99,141,861 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	99,127,403 - 99,140,638 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	4,258,347 - 4,279,119 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mest
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	5,799,057 - 5,811,110 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624783	5,798,141 - 5,816,595 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mest
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	108,814,326 - 108,825,955 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mest
101 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	36
Count of miRNA genes:	34
Interacting mature miRNAs:	36
Transcripts:	ENSRNOT00000072698
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	15644309	60644309	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	35113290	80113290	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	59753119	104753119	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	41400577	86400577	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	44425024	89425024	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	57613242	102613242	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	40490442	75726188	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	58079875	82597589	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	58817672	103817672	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	58080146	80212111	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	18900697	63900697	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	59836842	104836842	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	37269577	82269577	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	40471453	75939996	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	41400603	86400603	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	22288453	63245191	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	18900697	63900697	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	30448961	82336920	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	18913151	63913151	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	27862204	62997402	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	41400577	86400577	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21925151	66925151	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	58079875	92690793	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	57613242	102613242	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	57613242	102613242	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	59603319	80216952	Rat

Markers in Region

BE110063

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	59,365,190 - 59,365,342 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	58,063,499 - 58,063,650	NCBI	Rnor6.0
Rnor_5.0	4	57,822,156 - 57,822,307	UniSTS	Rnor5.0
Celera	4	54,463,664 - 54,463,815	UniSTS
RH 3.4 Map	4	347.3	UniSTS
Cytogenetic Map	4	q44	UniSTS
Cytogenetic Map	4	q22	UniSTS

BE110207

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	59,363,826 - 59,364,000 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	58,062,135 - 58,062,308	NCBI	Rnor6.0
Rnor_5.0	4	57,820,792 - 57,820,965	UniSTS	Rnor5.0
Celera	4	54,462,300 - 54,462,473	UniSTS
RH 3.4 Map	4	346.31	UniSTS
Cytogenetic Map	4	q44	UniSTS

BF396313

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	59,362,587 - 59,362,807 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	58,060,896 - 58,061,115	NCBI	Rnor6.0
Rnor_5.0	4	57,819,553 - 57,819,772	UniSTS	Rnor5.0
Celera	4	54,461,061 - 54,461,280	UniSTS
RH 3.4 Map	4	345.32	UniSTS
Cytogenetic Map	4	q44	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	65	158	91	90	59	92	59	6	350	189	9	137	78	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC062800	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000072698 ⟹ ENSRNOP00000065620

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	60,321,814 - 60,333,509 (+)	Ensembl
mRatBN7.2 Ensembl	4	59,354,447 - 59,366,145 (+)	Ensembl
Rnor_6.0 Ensembl	4	58,053,041 - 58,063,138 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098738 ⟹ ENSRNOP00000088966

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	60,323,540 - 60,333,509 (+)	Ensembl
mRatBN7.2 Ensembl	4	59,356,171 - 59,366,145 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000123752 ⟹ ENSRNOP00000104259

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	60,321,814 - 60,333,509 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000131398 ⟹ ENSRNOP00000109198

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	60,317,157 - 60,333,509 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000146143 ⟹ ENSRNOP00000105056

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	60,316,102 - 60,333,509 (+)	Ensembl

RefSeq Acc Id:

NM_001009617 ⟹ NP_001009617

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,321,814 - 60,332,288 (+)	NCBI
mRatBN7.2	4	59,354,445 - 59,364,919 (+)	NCBI
Rnor_6.0	4	58,052,786 - 58,063,227 (+)	NCBI
Rnor_5.0	4	57,811,101 - 57,821,884 (+)	NCBI
Celera	4	54,452,983 - 54,463,392 (+)	RGD

Sequence:

show sequence

GGGGGCCTCGGCCACCAGCACATCCCGGTGCATCCTCACAGGCGCAGCAGCCTTCCTCTGCGGC
AGCCGCACCTCGCCACCCGGCGTAGTGCTGCAGGCTCGCCCGAGTTGCCGCTTGCTGCCTCTTT
TGTCGCTGCCGCGGGCCGCCCTGCGGACCGTGGGCTGCGCCGAGGCCATCCCCGATCCTGTACC
GCTGTAGGCGCCTCGGCGCGCCCTGTGATCCGCAATCCTGCGGCGGGCGGCATGGGATAATGCG
GCCATGGTGCGCCGAGATCGCTTGCGCAGGATGAGGGAGTGGTGGGTCCAAGTAGGGCTCCTGG
CTGTGCCCTTGCTGGCTGCGTACCTGCACATCCCACCCCCTCAGCTCTCCCCTGCTCTGCACTC
ATGGAAGACTTCTGGCAAGTTTTTCACCTACAAGGGACTACGCATCTTCTACCAAGATTCTGTC
GGCGTGGTGGGAAGCCCTGAGATAGTTGTGCTTTTACATGGCTTTCCGACATCCAGCTATGACT
GGTACAAGATCTGGGAAGGGCTGACCCTGAGGTTCCATCGAGTGATTGCCCTGGATTTCTTAGG
CTTTGGCTTCAGTGACAAGCCGAGACCACATCAGTATTCCATATTTGAGCAGGCCAGCATCGTA
GAGTCCCTTCTGCGGCACCTGGGGCTCCAGAACCGCAGAATCAACCTACTGTCTCACGACTATG
GGGATATTGTTGCTCAGGAGCTGCTGTACAGGTACAAGCAGAATCGTTCTGGCCGTCTCACCAT
AAAGAGTCTCTGTCTGTCGAATGGAGGTATCTTTCCTGAGACCCATCGTCCTCTCCTTCTCCAA
AAGCTCCTCAAAGACGGAGGTGTGCTTTCACCCATCCTCACCAGGCTCATGAACTTCTTTGTGT
TCTCTCGAGGTCTCACTCCAGTCTTTGGACCATATACTCGACCCACTGAGAGTGAGCTGTGGGA
CATGTGGGCTGGGATTCGCAACAATGACGGGAACCTGGTCATTGACAGTCTTTTACAGTACATC
AATCAAAGGAAGAAATTTAGAAGACGCTGGGTGGGAGCACTTGCTTCTGTGACCATCCCCATTC
ATTTTATCTATGGGCCATTGGATCCTATAAATCCGTATCCAGAGTTTTTGGAGCTGTACAGGAA
AACGCTGCCGCGGTCCACAGTGTCGATTCTGGATGACCACATTAGCCACTACCCACAGCTAGAG
GATCCCATGGGCTTCTTGAATGCATATATGGGCTTCATCAACTCCTTCTGAGCTGGAAAGAGTA
GCTTCCCTGTATTACCTCCCCCATTCTCGTATCTGTGTGTATTCCACTTAGAAATGCCCCAAAG
AGGTCCTGGTCAGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009617	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH62800	(Get FASTA)	NCBI Sequence Viewer
	EDM15263	(Get FASTA)	NCBI Sequence Viewer
	EDM15264	(Get FASTA)	NCBI Sequence Viewer
	EDM15265	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065620
	ENSRNOP00000065620.3
GenBank Protein	Q6P5P5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009617 ⟸ NM_001009617

- UniProtKB:

Q6P5P5 (UniProtKB/Swiss-Prot), M0R830 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKTSGKFFTYKGLRIFYQDSVG
VVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHQYSIFEQASIVE
SLLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQK
LLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPTESELWDMWAGIRNNDGNLVIDSLLQYIN
QRKKFRRRWVGALASVTIPIHFIYGPLDPINPYPEFLELYRKTLPRSTVSILDDHISHYPQLED
PMGFLNAYMGFINSF

hide sequence

Ensembl Acc Id:

ENSRNOP00000065620 ⟸ ENSRNOT00000072698

Ensembl Acc Id:

ENSRNOP00000088966 ⟸ ENSRNOT00000098738

Ensembl Acc Id:

ENSRNOP00000104259 ⟸ ENSRNOT00000123752

Ensembl Acc Id:

ENSRNOP00000109198 ⟸ ENSRNOT00000131398

Ensembl Acc Id:

ENSRNOP00000105056 ⟸ ENSRNOT00000146143

Protein Domains

AB hydrolase-1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6P5P5-F1-model_v2	AlphaFold	Q6P5P5	1-335	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1594589	AgrOrtholog
BioCyc Gene	G2FUF-45339	BioCyc
Ensembl Genes	ENSRNOG00000048088	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000072698	ENTREZGENE
	ENSRNOT00000072698.3	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1820	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6889877	IMAGE-MGC_LOAD
InterPro	AB_hydrolase	UniProtKB/Swiss-Prot
	AB_hydrolase_1	UniProtKB/Swiss-Prot
	AB_hydrolase_sf	UniProtKB/Swiss-Prot
	Epox_hydrolase-like	UniProtKB/Swiss-Prot
KEGG Report	rno:58827	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:73011	IMAGE-MGC_LOAD
NCBI Gene	58827	ENTREZGENE
PANTHER	HYDROLASE, PUTATIVE (AFU_ORTHOLOGUE AFUA_2G14860)-RELATED	UniProtKB/Swiss-Prot
	MONOACYLGLYCEROL LIPASE	UniProtKB/Swiss-Prot
Pfam	Abhydrolase_1	UniProtKB/Swiss-Prot
PhenoGen	Mest	PhenoGen
PRINTS	EPOXHYDRLASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000048088	RatGTEx
Superfamily-SCOP	SSF53474	UniProtKB/Swiss-Prot
UniProt	A0A8I6A954_RAT	UniProtKB/TrEMBL
	A0ABK0L5G9_RAT	UniProtKB/TrEMBL
	A0ABK0LMP3_RAT	UniProtKB/TrEMBL
	A0ABK0LY81_RAT	UniProtKB/TrEMBL
	A6IEH6_RAT	UniProtKB/TrEMBL
	A6IEH8_RAT	UniProtKB/TrEMBL
	M0R830	ENTREZGENE, UniProtKB/TrEMBL
	MEST_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-14	Mest	mesoderm specific transcript	Mest	mesoderm specific transcript homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-12-15	Mest	mesoderm specific transcript homolog (mouse)	Mest	mesoderm specific transcript	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	Mest	mesoderm specific transcript			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI