Advanced Search (OLGA)

Gene: Hcar1 (hydroxycarboxylic acid receptor 1) Rattus norvegicus

Analyze

Symbol:

Hcar1

Name:

hydroxycarboxylic acid receptor 1

RGD ID:

1586364

Description:

Predicted to enable G protein-coupled receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and negative regulation of lipid catabolic process. Predicted to be active in plasma membrane. Orthologous to human HCAR1 (hydroxycarboxylic acid receptor 1); INTERACTS WITH 1-naphthyl isothiocyanate; acetamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G protein-coupled receptor 81; G-protein coupled receptor 81; Gpr81; LOC689936; similar to G protein-coupled receptor 81

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	38,371,593 - 38,374,847 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	38,371,374 - 38,407,284 (+)	Ensembl				GRCr8
mRatBN7.2	12	32,710,680 - 32,713,934 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,711,027 - 32,712,082 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	33,889,596 - 33,890,651 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,500,949 - 34,502,004 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,552,835 - 33,553,890 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,145,177 - 38,146,232 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,144,855 - 38,146,271 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	40,014,637 - 40,015,692 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	33,847,986 - 33,849,041 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	34,397,576 - 34,398,631 (+)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

copper(II) sulfate (ISO)

dimethyl sulfoxide (ISO)

diquat (ISO)

endosulfan (EXP)

fulvestrant (ISO)

lipopolysaccharide (ISO)

menadione (ISO)

mono(2-ethylhexyl) phthalate (ISO)

ozone (ISO)

perfluorooctanoic acid (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (ISO)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (IEA,ISO)

G protein-coupled receptor signaling pathway (IBA,IEA,ISO)

negative regulation of lipid catabolic process (IEA,ISO)

signal transduction (IEA)

Cellular Component

membrane (IEA,ISO)

plasma membrane (IBA,IEA,ISO)

Molecular Function

G protein-coupled receptor activity (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:19047060	PMID:25495836	PMID:31881352	PMID:35240875	PMID:35856408	PMID:38294536

Genomics

Comparative Map Data

Hcar1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	38,371,593 - 38,374,847 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	38,371,374 - 38,407,284 (+)	Ensembl				GRCr8
mRatBN7.2	12	32,710,680 - 32,713,934 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,711,027 - 32,712,082 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	33,889,596 - 33,890,651 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,500,949 - 34,502,004 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,552,835 - 33,553,890 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,145,177 - 38,146,232 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,144,855 - 38,146,271 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	40,014,637 - 40,015,692 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	33,847,986 - 33,849,041 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	34,397,576 - 34,398,631 (+)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

HCAR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	122,726,076 - 122,730,844 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	122,726,076 - 122,730,844 (-)	Ensembl			hg38	GRCh38
GRCh37	12	123,210,623 - 123,215,391 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	121,778,106 - 121,781,082 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	121,735,610 - 121,740,009	NCBI
Celera	12	122,804,963 - 122,807,939 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	120,172,181 - 120,175,157 (-)	NCBI		HuRef
CHM1_1	12	123,180,354 - 123,183,330 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	122,721,458 - 122,726,228 (-)	NCBI		T2T-CHM13v2.0

Hcar1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	124,014,802 - 124,018,066 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	124,014,799 - 124,018,083 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	123,876,739 - 123,880,003 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	123,876,736 - 123,880,020 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	124,326,745 - 124,330,029 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	124,137,596 - 124,140,621 (-)	NCBI		MGSCv36	mm8
Celera	5	120,948,767 - 120,952,052 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	63.24	NCBI

Hcar1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	5,998,796 - 6,002,093 (+)	Ensembl
ChiLan1.0	NW_004955482	5,998,796 - 6,002,093 (+)	NCBI	ChiLan1.0	ChiLan1.0

HCAR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	130,819,641 - 130,824,772 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	130,816,017 - 130,821,148 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	120,330,294 - 120,335,425 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	124,566,016 - 124,569,288 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	124,567,699 - 124,568,739 (-)	Ensembl			panPan2	panpan1.1

HCAR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	6,734,818 - 6,735,906 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	6,734,818 - 6,735,906 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	6,895,785 - 6,896,873 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	6,984,011 - 6,985,099 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	6,983,610 - 6,986,835 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	6,915,982 - 6,917,070 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	7,009,736 - 7,010,824 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	6,963,158 - 6,964,246 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hcar1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	157,585,480 - 157,589,414 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	1,890,439 - 1,891,480 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	1,890,027 - 1,893,632 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HCAR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	30,105,285 - 30,106,307 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	30,105,285 - 30,106,307 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	31,795,357 - 31,796,379 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HCAR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	118,055,943 - 118,087,946 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	118,056,603 - 118,057,643 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	127,260,574 - 127,264,069 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hcar1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	22,794,256 - 22,795,452 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	22,792,224 - 22,798,189 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Hcar1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	29,976,665 - 29,977,928 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Hcar1
29 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	63
Count of miRNA genes:	52
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000032274
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	29775522	42298555	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	34243475	43352593	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat

Markers in Region

D10Mgh10

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	35,509,383 - 35,509,521 (+)	Marker Load Pipeline
Rnor_6.0	10	36,185,929 - 36,186,066	NCBI	Rnor6.0
Rnor_5.0	10	35,954,931 - 35,955,068	UniSTS	Rnor5.0
RGSC_v3.4	10	36,254,741 - 36,254,879	RGD	RGSC3.4
RGSC_v3.4	10	36,254,742 - 36,254,879	UniSTS	RGSC3.4
Celera	10	34,362,292 - 34,362,429	UniSTS
RGSC_v3.1	10	36,255,791 - 36,255,928	RGD
RH 3.4 Map	10	374.6	UniSTS
RH 3.4 Map	10	374.6	RGD
RH 2.0 Map	10	401.0	RGD
SHRSP x BN Map	10	34.04	RGD
FHH x ACI Map	10	33.0199	RGD
Cytogenetic Map	10	q22	UniSTS

D10Rat51

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	11,072,115 - 11,072,299 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	11,278,340 - 11,278,521	NCBI	Rnor6.0
Rnor_5.0	10	10,039,921 - 10,040,102	UniSTS	Rnor5.0
RGSC_v3.4	10	11,212,678 - 11,212,859	UniSTS	RGSC3.4
Celera	10	10,032,428 - 10,032,609	UniSTS
RGSC_v3.1	10	11,212,677 - 11,212,857	RGD
RH 3.4 Map	10	127.93	RGD
RH 3.4 Map	10	127.93	UniSTS
RH 2.0 Map	10	54.1	RGD
SHRSP x BN Map	10	6.1	RGD
Cytogenetic Map	10	q12	UniSTS

D10Rat9

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	95,604,537 - 95,604,677 (+)	Marker Load Pipeline
RGSC_v3.4	10	99,588,306 - 99,588,446	RGD	RGSC3.4
RGSC_v3.4	10	99,588,307 - 99,588,446	UniSTS	RGSC3.4
Celera	10	93,755,287 - 93,755,428	UniSTS
RGSC_v3.1	10	99,602,676 - 99,602,816	RGD
RH 3.4 Map	10	1071.59	UniSTS
RH 3.4 Map	10	1071.59	RGD
RH 2.0 Map	10	1181.2	RGD
SHRSP x BN Map	10	77.15	RGD
Cytogenetic Map	10	q32.1	UniSTS

D10Rat113

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	20,074,644 - 20,074,883 (+)	Marker Load Pipeline
mRatBN7.2	10	19,570,513 - 19,570,752 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	19,922,916 - 19,923,154	NCBI	Rnor6.0
Rnor_5.0	10	19,800,315 - 19,800,553	UniSTS	Rnor5.0
RGSC_v3.4	10	19,981,830 - 19,982,189	RGD	RGSC3.4
RGSC_v3.4	10	19,981,882 - 19,982,120	UniSTS	RGSC3.4
Celera	10	19,200,238 - 19,200,476	UniSTS
RGSC_v3.1	10	19,982,931 - 19,983,169	RGD
RH 3.4 Map	10	214.43	RGD
RH 3.4 Map	10	214.43	UniSTS
RH 2.0 Map	10	217.1	RGD
SHRSP x BN Map	10	20.49	RGD
FHH x ACI Map	10	14.03	RGD
Cytogenetic Map	10	q12	UniSTS

D10Rat96

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	6,660,923 - 6,661,118 (+)	Marker Load Pipeline
mRatBN7.2	10	6,154,182 - 6,154,377 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	6,229,095 - 6,229,289	NCBI	Rnor6.0
Rnor_5.0	10	5,044,642 - 5,044,836	UniSTS	Rnor5.0
RGSC_v3.4	10	6,172,610 - 6,172,805	RGD	RGSC3.4
RGSC_v3.4	10	6,172,611 - 6,172,805	UniSTS	RGSC3.4
Celera	10	5,158,089 - 5,158,283	UniSTS
RGSC_v3.1	10	6,172,611 - 6,172,805	RGD
RH 3.4 Map	10	70.5	UniSTS
RH 3.4 Map	10	70.5	RGD
RH 2.0 Map	10	0.0	RGD
SHRSP x BN Map	10	0.08	RGD
FHH x ACI Map	10	0.0	RGD
Cytogenetic Map	12	q15	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	11	67	143	91	90	59	25	59	6	274	124	11	115	73	90	31	10	10

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001145334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU809461	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU809462	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032274 ⟹ ENSRNOP00000032350

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	38,371,374 - 38,407,284 (+)	Ensembl
mRatBN7.2 Ensembl	12	32,711,027 - 32,712,082 (+)	Ensembl
Rnor_6.0 Ensembl	12	38,144,855 - 38,146,271 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000156806 ⟹ ENSRNOP00000107662

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	38,371,598 - 38,373,996 (+)	Ensembl

RefSeq Acc Id:

NM_001145334 ⟹ NP_001138806

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	38,371,593 - 38,374,847 (+)	NCBI
mRatBN7.2	12	32,710,680 - 32,713,934 (+)	NCBI
Rnor_6.0	12	38,145,177 - 38,146,232 (+)	NCBI
Rnor_5.0	12	40,014,637 - 40,015,692 (+)	NCBI
RGSC_v3.4	12	33,847,986 - 33,849,041 (+)	RGD
Celera	12	34,397,576 - 34,398,631 (+)	RGD

Sequence:

show sequence

ATGCTCTTCCTCTCTCCGAGTGCTATGGACAACGGGTCGTGCTGTCTCATCGAGGGGGAACCCA
TCACCCAGGTAATGCCACCTTTACTCATCCTGGCCTTCCTGCTTGGAGCCCTGGGCAACGGCCT
AGCCCTGTGTGGTTTCTGCTTTCACATGAAGACCTGGAAGTCGAGCACTATTTACCTTTTCAAC
TTGGCTGTAGCCGATTTTCTCCTCATGATCTGCCTACCCCTTCGGACAGACTACTACCTCAGAC
GTAGGCATTGGATTTTGGGGGATATTCCCTGCCGCCTGGTCCTCTTCATGCTGGCCATGAATAG
GGCCGGAAGCATTGTCTTCCTCACTGTGGTGGCCGTGGACAGGTATTTCAAAGTGGTCCACCCC
CACCATATGGTGAACGCCATCTCCAATCGGACTGCAGCTGCCATCGTCTGTGTCCTCTGGACTT
TGGTCATCTTGGGGACTGTGTATCTTCTGATGGAGAGTCACCTGTGTGTGCGGGGGATGGTGTC
ATCTTGTGAGAGCTTCATCATGGAGTCAGCCAACGGGTGGCACGATATCATGTTCCAGCTGGAG
TTCTTCCTGCCCCTGACCATCATCTTGTTCTGCTCCTTCAAAGTTGTTTGGAGCCTGAGACAGA
GGCAACAGCTGACCAGACAGGCTCGGATGAGGAGGGCCACCCGGTTCATCATGGTGGTGGCTTC
CGTGTTCATCACGTGTTACCTGCCCAGCGTGTTGGCGAGGCTCTACTTCCTCTGGACGGTGCCC
TCCAGTGCTTGTGACCCCTCTGTCCACATAGCTCTCCATGTCACCCTGAGTCTCACCTACCTGA
ACAGCATGCTGGACCCTCTTGTGTACTACTTTTCAAGCCCCTCGTTCCCCAAATTCTACGCCAA
GCTCAAAATCCGCAGCTTGAAACCCAGACGCCCAGGACGCTCGCAGGCACGGAGGTCGGAAGAG
ATGCCAATTTCGAATCTCTGTCGTAAGAGTTCCACCGATGTGGTAAATAGTTCCCAGAGGCCGT
CTGACGGGCAGTGGGGTCTCCAAGTGTGTTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001138806	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ACJ03847	(Get FASTA)	NCBI Sequence Viewer
	ACJ03848	(Get FASTA)	NCBI Sequence Viewer
	EDM13618	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000032350
	ENSRNOP00000032350.4
	ENSRNOP00000107662.1

RefSeq Acc Id:

NP_001138806 ⟸ NM_001145334

- UniProtKB:

B9UM24 (UniProtKB/TrEMBL), G3V906 (UniProtKB/TrEMBL), A6J129 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLFLSPSAMDNGSCCLIEGEPITQVMPPLLILAFLLGALGNGLALCGFCFHMKTWKSSTIYLFN
LAVADFLLMICLPLRTDYYLRRRHWILGDIPCRLVLFMLAMNRAGSIVFLTVVAVDRYFKVVHP
HHMVNAISNRTAAAIVCVLWTLVILGTVYLLMESHLCVRGMVSSCESFIMESANGWHDIMFQLE
FFLPLTIILFCSFKVVWSLRQRQQLTRQARMRRATRFIMVVASVFITCYLPSVLARLYFLWTVP
SSACDPSVHIALHVTLSLTYLNSMLDPLVYYFSSPSFPKFYAKLKIRSLKPRRPGRSQARRSEE
MPISNLCRKSSTDVVNSSQRPSDGQWGLQVC

hide sequence

Ensembl Acc Id:

ENSRNOP00000032350 ⟸ ENSRNOT00000032274

Ensembl Acc Id:

ENSRNOP00000107662 ⟸ ENSRNOT00000156806

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V906-F1-model_v2	AlphaFold	G3V906	1-351	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1586364	AgrOrtholog
BioCyc Gene	G2FUF-19329	BioCyc
Ensembl Genes	ENSRNOG00000026661	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000032274	ENTREZGENE
	ENSRNOT00000032274.7	UniProtKB/TrEMBL
	ENSRNOT00000156806.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	HCARs	UniProtKB/TrEMBL
KEGG Report	rno:689936	UniProtKB/TrEMBL
NCBI Gene	689936	ENTREZGENE
PANTHER	HYDROXYCARBOXYLIC ACID RECEPTOR 2	UniProtKB/TrEMBL
	PTHR46048:SF3	UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/TrEMBL
PhenoGen	Hcar1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	P2YPURNOCPTR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000026661	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0ABK0LYQ0_RAT	UniProtKB/TrEMBL
	A6J129	ENTREZGENE, UniProtKB/TrEMBL
	B9UM24	ENTREZGENE, UniProtKB/TrEMBL
	G3V906	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Hcar1	hydroxycarboxylic acid receptor 1	Gpr81	G protein-coupled receptor 81	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-08	Gpr81	G protein-coupled receptor 81	LOC687572	similar to G protein-coupled receptor 81	Data merged from RGD:1584193	1643240	APPROVED
2008-03-06	Gpr81	G protein-coupled receptor 81	LOC689936	similar to G protein-coupled receptor 81	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC689936	similar to G protein-coupled receptor 81			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC687572	similar to G protein-coupled receptor 81			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message