Advanced Search (OLGA)

Gene: Spaca5 (sperm acrosome associated 5) Rattus norvegicus

Analyze

Symbol:

Spaca5

Name:

sperm acrosome associated 5

RGD ID:

1584964

Description:

Predicted to enable lysozyme activity. Predicted to be involved in fusion of sperm to egg plasma membrane involved in single fertilization. Predicted to be active in acrosomal vesicle and sperm flagellum. Orthologous to several human genes including SPACA5 (sperm acrosome associated 5); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC314431; similar to PNPK6288; sperm acrosome-associated protein 5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SPACA5 (sperm acrosome associated 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Spaca5 (sperm acrosome associated 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Spaca5 (sperm acrosome associated 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SPACA5 (sperm acrosome associated 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SPACA5 (sperm acrosome associated 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SPACA5 (sperm acrosome associated 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SPACA5 (sperm acrosome associated 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SPACA5B (sperm acrosome associated 5B)	HGNC	Ensembl, HomoloGene, NCBI, OrthoDB, Panther
Homo sapiens (human):	CCDC89 (coiled-coil domain containing 89)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SPACA5 (sperm acrosome associated 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SPACA5B (sperm acrosome associated 5B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Spaca5 (sperm acrosome associated 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lyz (lysozyme)	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11159	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG16756	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG16799	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG16799	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8492	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	mgc89221	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	mgc89221	Alliance	DIOPT (Ensembl Compara\|OMA\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	spaca5	Alliance	DIOPT (OMA\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	3,472,369 - 3,475,552 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	3,472,369 - 3,475,822 (-)	Ensembl				GRCr8
mRatBN7.2	X	918,817 - 922,000 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	918,817 - 922,049 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	946,948 - 950,132 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	4,422,640 - 4,425,824 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	743,174 - 746,359 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	912,770 - 915,953 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	912,770 - 915,953 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	907,618 - 910,801 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	X	1,488,462 - 1,491,645 (-)	NCBI		Celera
Cytogenetic Map	X	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,4'-trichlorobiphenyl (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (ISO)

diquat (ISO)

genistein (ISO)

gentamycin (EXP)

mono(2-ethylhexyl) phthalate (ISO)

Monobutylphthalate (EXP)

paracetamol (EXP)

PCB138 (ISO)

permethrin (ISO)

sodium fluoride (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

fusion of sperm to egg plasma membrane involved in single fertilization (IBA)

Cellular Component

acrosomal vesicle (IBA)

sperm flagellum (IBA)

Molecular Function

lysozyme activity (IBA,IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Spaca5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	3,472,369 - 3,475,552 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	3,472,369 - 3,475,822 (-)	Ensembl				GRCr8
mRatBN7.2	X	918,817 - 922,000 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	918,817 - 922,049 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	946,948 - 950,132 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	4,422,640 - 4,425,824 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	743,174 - 746,359 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	912,770 - 915,953 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	912,770 - 915,953 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	907,618 - 910,801 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	X	1,488,462 - 1,491,645 (-)	NCBI		Celera
Cytogenetic Map	X	q11	NCBI

SPACA5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	48,004,336 - 48,009,733 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	48,004,336 - 48,009,733 (+)	Ensembl			hg38	GRCh38
GRCh37	X	47,863,734 - 47,869,130 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	47,748,678 - 47,754,074 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	X	52,182,559 - 52,187,955 (+)	NCBI		Celera
Cytogenetic Map	X	p11.23	NCBI
HuRef	X	45,698,884 - 45,704,280 (+)	NCBI		HuRef
CHM1_1	X	47,894,879 - 47,900,324 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	47,414,513 - 47,419,909 (+)	NCBI		T2T-CHM13v2.0

Spaca5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	20,934,669 - 20,944,197 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	20,934,645 - 20,944,202 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	X	21,068,430 - 21,077,958 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	21,068,406 - 21,077,963 (+)	Ensembl			mm10	GRCm38
MGSCv37	X	20,645,532 - 20,655,089 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	X	20,225,447 - 20,234,847 (+)	NCBI		MGSCv36	mm8
Celera	X	19,202,482 - 19,211,886 (+)	NCBI		Celera
Cytogenetic Map	X	A1.3	NCBI
cM Map	X	16.59	NCBI

Spaca5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955516	103,611 - 106,090 (-)	Ensembl
ChiLan1.0	NW_004955516	103,674 - 106,082 (-)	NCBI	ChiLan1.0	ChiLan1.0

SPACA5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	49,628,747 - 49,631,850 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	49,632,342 - 49,635,222 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	40,435,554 - 40,441,190 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	48,328,726 - 48,334,106 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

SPACA5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	41,590,329 - 41,612,133 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	41,353,440 - 41,593,082 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	15,968,120 - 15,989,904 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	41,727,776 - 41,749,559 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	41,727,802 - 41,731,591 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	41,715,021 - 41,736,798 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	41,703,102 - 41,724,897 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	41,796,676 - 41,818,457 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

SPACA5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	42,476,587 - 42,478,921 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	X	42,476,719 - 42,478,783 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	47,046,163 - 47,048,227 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SPACA5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	45,170,226 - 45,175,615 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666076	10,436,318 - 10,441,371 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Spaca5
16 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	7
Count of miRNA genes:	7
Interacting mature miRNAs:	7
Transcripts:	ENSRNOT00000075264
Prediction methods:	Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1970440	46970440	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	10	17	43	49	48	17	23	17	6	112	60	23	18	35	31	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000075264 ⟹ ENSRNOP00000067235

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	X	3,472,369 - 3,475,822 (-)	Ensembl
mRatBN7.2 Ensembl	X	918,817 - 922,049 (-)	Ensembl
Rnor_6.0 Ensembl	X	912,770 - 915,953 (-)	Ensembl

RefSeq Acc Id:

NM_001108058 ⟹ NP_001101528

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	3,472,369 - 3,475,552 (-)	NCBI
mRatBN7.2	X	918,817 - 922,000 (-)	NCBI
Rnor_6.0	X	912,770 - 915,953 (-)	NCBI
Rnor_5.0	X	907,618 - 910,801 (-)	NCBI
Celera	X	1,488,462 - 1,491,645 (-)	RGD

Sequence:

show sequence

ATGCAGTTCTGCAGTACTGTGGTGGTGATCTTGGCCACACTGTTGCTTGCCACAGTGGATGCCA
AGATTTATGAACGCTGTGAGCTGGCAAGGAAGCTGGAGAAAGCTGGCCTCAATGGCTTCAAAGG
CTACACTGTTGGAGACTGGCTGTGTGTGGCACACTATGAAAGTGGTTTTGACACCTCTTTTGTG
GACCACAATCCAGATGGCAGCAGTGAATATGGCATTTTCCAGTTGAACTCTGCTTGGTGGTGTA
ATAATGGCATCACACCCACTCAGAACCTCTGCCACATGGATTGTAATGACCTACTCAACCGCCA
TATTCTGGATGATATCATGTGTGCCAAGAGGGTTGTATCCTCACATAAGAGTATGAAGGCCTGG
GATTCCTGGACCCGGCACTGTGCTGGTCATGATTTATCTGAATGGCTCAAGGGGTGTGATGTGC
CTCTGAAAGCTGACTCAAACTATGATGACTGGTGACTCAGATTTTATAAAGATAGAAATTCCAT
TTTATCTTTTGTGGGTTTAATAAAAGTTGGCATATATAAAT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101528	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL97736	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067235.2

RefSeq Acc Id:	NP_001101528 ⟸ NM_001108058
- Peptide Label:	precursor
- UniProtKB:	M0RCC1 (UniProtKB/TrEMBL), A6JZP9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQFCSTVVVILATLLLATVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFDTSFV DHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVSSHKSMKAW DSWTRHCAGHDLSEWLKGCDVPLKADSNYDDW hide sequence

Ensembl Acc Id:

ENSRNOP00000067235 ⟸ ENSRNOT00000075264

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RCC1-F1-model_v2	AlphaFold	M0RCC1	1-160	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1584964	AgrOrtholog
BioCyc Gene	G2FUF-3207	BioCyc
Ensembl Genes	ENSRNOG00000045622	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000075264.3	UniProtKB/TrEMBL
Gene3D-CATH	1.10.530.10	UniProtKB/TrEMBL
InterPro	Glyco_hydro_22	UniProtKB/TrEMBL
	Glyco_hydro_22_lys	UniProtKB/TrEMBL
	Lysozyme-like_dom	UniProtKB/TrEMBL
KEGG Report	rno:314431	UniProtKB/TrEMBL
NCBI Gene	314431	ENTREZGENE
PANTHER	PTHR11407	UniProtKB/TrEMBL
	PTHR11407:SF31	UniProtKB/TrEMBL
Pfam	Lys	UniProtKB/TrEMBL
PhenoGen	Spaca5	PhenoGen
PRINTS	LYSOZYME	UniProtKB/TrEMBL
	LYZLACT	UniProtKB/TrEMBL
PROSITE	LACTALBUMIN_LYSOZYME_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000045622	RatGTEx
SMART	LYZ1	UniProtKB/TrEMBL
Superfamily-SCOP	SSF53955	UniProtKB/TrEMBL
UniProt	A6JZP9	ENTREZGENE, UniProtKB/TrEMBL
	M0RCC1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-05	Spaca5	sperm acrosome associated 5	LOC314431	similar to PNPK6288	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC314431	similar to PNPK6288			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message