Advanced Search (OLGA)

Gene: Slbp (stem-loop histone mRNA binding protein) Rattus norvegicus

Analyze

Symbol:

Slbp

Name:

stem-loop histone mRNA binding protein

RGD ID:

1584682

Description:

Predicted to enable histone pre-mRNA stem-loop binding activity; identical protein binding activity; and mRNA binding activity. Predicted to be involved in cap-dependent translational initiation; mRNA 3'-end processing by stem-loop binding activity and cleavage; and mRNA transport. Predicted to be located in nucleus. Predicted to be part of histone mRNA stem-loop binding activity complex and histone pre-mRNA 3'end processing complex. Predicted to be active in cytoplasm. Orthologous to human SLBP (stem-loop histone mRNA binding protein); INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

histone RNA hairpin-binding protein; LOC681062; MGC187387; similar to stem-loop binding protein; stem-loop binding protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLBP (stem-loop histone mRNA binding protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Slbp (stem-loop binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slbp (stem-loop histone mRNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLBP (stem-loop histone mRNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLBP (stem-loop histone mRNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slbp (stem-loop histone mRNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLBP (stem-loop histone mRNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLBP (stem-loop histone mRNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slbp (stem-loop histone mRNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Slbp (stem-loop histone mRNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PPP1R12B (protein phosphatase 1 regulatory subunit 12B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SLBP (stem-loop histone mRNA binding protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slbp (stem-loop binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slbp (stem-loop binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slbp (stem-loop binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cdl-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Slbp	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slbp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	81,295,479 - 81,306,446 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	81,296,223 - 81,306,447 (+)	Ensembl				GRCr8
mRatBN7.2	14	77,071,441 - 77,081,911 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	77,071,632 - 77,081,906 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	81,524,007 - 81,534,181 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	82,764,607 - 82,774,784 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	79,209,907 - 79,220,082 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	82,356,916 - 82,366,368 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	82,356,916 - 82,366,368 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	83,046,030 - 83,056,021 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	82,767,415 - 82,778,030 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	75,995,251 - 76,005,216 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

coloboma (ISO)

optic atrophy (ISO)

Retinal Dysplasia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-colchicine (ISO)

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3H-1,2-dithiole-3-thione (EXP)

4-hydroxyphenyl retinamide (ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

adenine (ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

amphetamine (EXP)

Aroclor 1254 (ISO)

arsane (EXP)

arsenic atom (EXP)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

butyric acid (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

cisplatin (ISO)

corosolic acid (ISO)

coumarin (ISO)

coumestrol (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

DDE (ISO)

deguelin (ISO)

dibutyl phthalate (ISO)

dioxygen (EXP)

doxorubicin (ISO)

Enterolactone (ISO)

enzyme inhibitor (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

hydroxyurea (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

menadione (ISO)

methapyrilene (EXP,ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

mitomycin C (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodiethylamine (EXP)

nicotine (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP)

picoxystrobin (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

pyrogallol (ISO)

resveratrol (EXP,ISO)

rotenone (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

triadimefon (EXP)

Tributyltin oxide (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cap-dependent translational initiation (IEA,ISO)

mRNA 3'-end processing by stem-loop binding and cleavage (IBA,IEA,ISO)

mRNA transport (IBA,IEA,ISO)

Cellular Component

cytoplasm (IBA,IEA,ISO)

cytosol (IEA,ISO)

histone pre-mRNA 3'end processing complex (IBA,IEA,ISO)

nucleolus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

ribonucleoprotein complex (IEA,ISO)

Molecular Function

histone pre-mRNA stem-loop binding (IBA,IEA,ISO)

identical protein binding (IEA,ISO)

mRNA binding (IBA,IEA,ISO)

protein binding (ISO)

RNA binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15358832	PMID:15829567	PMID:16912046	PMID:19155325	PMID:19470752	PMID:22658674	PMID:23286197

Genomics

Comparative Map Data

Slbp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	81,295,479 - 81,306,446 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	81,296,223 - 81,306,447 (+)	Ensembl				GRCr8
mRatBN7.2	14	77,071,441 - 77,081,911 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	77,071,632 - 77,081,906 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	81,524,007 - 81,534,181 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	82,764,607 - 82,774,784 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	79,209,907 - 79,220,082 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	82,356,916 - 82,366,368 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	82,356,916 - 82,366,368 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	83,046,030 - 83,056,021 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	82,767,415 - 82,778,030 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	75,995,251 - 76,005,216 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

SLBP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	1,692,731 - 1,712,319 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	1,692,731 - 1,712,344 (-)	Ensembl			hg38	GRCh38
GRCh37	4	1,694,458 - 1,714,046 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	1,664,325 - 1,683,828 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	1,661,757 - 1,681,261	NCBI
Celera	4	1,605,626 - 1,625,082 (-)	NCBI		Celera
Cytogenetic Map	4	p16.3	NCBI
HuRef	4	1,637,465 - 1,656,925 (-)	NCBI		HuRef
CHM1_1	4	1,692,305 - 1,711,989 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	1,690,606 - 1,710,149 (-)	NCBI		T2T-CHM13v2.0

Slbp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	33,797,399 - 33,809,918 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	33,792,296 - 33,809,918 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	33,640,055 - 33,652,574 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	33,634,952 - 33,652,574 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	33,982,711 - 33,994,955 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	33,956,919 - 33,969,163 (-)	NCBI		MGSCv36	mm8
Celera	5	31,116,183 - 31,128,422 (-)	NCBI		Celera
Cytogenetic Map	5	B2	NCBI
cM Map	5	17.83	NCBI

Slbp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955514	955,296 - 967,327 (-)	Ensembl
ChiLan1.0	NW_004955514	954,489 - 968,670 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLBP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	2,021,762 - 2,041,101 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	1,956,969 - 1,976,729 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	1,830,247 - 1,849,890 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	1,744,612 - 1,772,962 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	1,744,616 - 1,763,796 (-)	Ensembl			panPan2	panpan1.1

SLBP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	62,386,982 - 62,401,541 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	62,386,977 - 62,400,891 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	64,904,699 - 64,919,261 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	62,862,384 - 62,876,780 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	62,862,384 - 62,876,763 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	62,355,910 - 62,370,480 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	62,559,430 - 62,573,999 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	62,918,670 - 62,933,236 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Slbp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	67,970,403 - 67,979,216 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936477	21,671,842 - 21,680,915 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936477	21,672,143 - 21,680,899 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLBP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	802,940 - 818,216 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	802,940 - 818,161 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	321,600 - 332,488 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLBP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	47,054,154 - 47,075,104 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	47,054,787 - 47,074,537 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666051	3,430,870 - 3,451,975 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slbp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624755	25,699,977 - 25,714,348 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Slbp
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	71,188,314 - 71,198,481 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Slbp
69 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	80
Count of miRNA genes:	69
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000040229
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	38023710	83023710	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	59848686	104848686	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	77914838	104348525	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39009444	84009444	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	72970210	87582095	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30674469	85041098	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	74255551	109089856	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	77640071	96755654	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	38023710	83023710	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	62398852	107398852	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	100078267	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	60854936	105854936	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	74255551	109089856	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	77640071	96755654	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	59848686	104848686	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	38023710	83023710	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42616258	99224555	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	65920283	99224555	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39411170	87582095	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	38023710	83023710	Rat

Markers in Region

RH134761

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	77,070,387 - 77,070,595 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	82,355,601 - 82,355,808	NCBI	Rnor6.0
Rnor_5.0	14	83,044,986 - 83,045,193	UniSTS	Rnor5.0
RGSC_v3.4	14	82,766,100 - 82,766,307	UniSTS	RGSC3.4
RH 3.4 Map	14	504.78	UniSTS
Cytogenetic Map	14	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001130988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092440	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC167755	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000040229 ⟹ ENSRNOP00000047799

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	81,296,223 - 81,306,447 (+)	Ensembl
mRatBN7.2 Ensembl	14	77,071,632 - 77,081,906 (+)	Ensembl
Rnor_6.0 Ensembl	14	82,356,916 - 82,366,368 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096081 ⟹ ENSRNOP00000093876

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	81,296,223 - 81,306,447 (+)	Ensembl
mRatBN7.2 Ensembl	14	77,071,632 - 77,081,906 (+)	Ensembl

RefSeq Acc Id:

NM_001130988 ⟹ NP_001124460

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	81,296,248 - 81,306,446 (+)	NCBI
mRatBN7.2	14	77,071,703 - 77,081,906 (+)	NCBI
Rnor_6.0	14	82,356,916 - 82,366,368 (+)	NCBI
Rnor_5.0	14	83,046,030 - 83,056,021 (+)	NCBI
RGSC_v3.4	14	82,767,415 - 82,778,030 (+)	RGD
Celera	14	75,995,251 - 76,005,216 (+)	RGD

Sequence:

show sequence

TGAGGTTCCTGCTGGTGAGCTCTCCTTCAAACCACCGCCGCCATGGCCTGCAGACCTAGAAGCC
CACCCCGTTACGGGAGTCGCCGCGACGGCGGTGCGAGCCCGCGGTCTCCTGCGCGATGGAGTCT
CGGACGGAAGCGCAGAGCGGACGGAAGAGACCGGAAGCCTGAGGACTCCGAGGAAGGCGAGCTC
CAGACTGCAGACCATCGACCTGAAAGCTTTACAACGCCTGAAGGCCATAAGCCCCGTTCTAGAT
GTTCTGACTGGGCAAGCGCAGTTGAAGAAGATGAAATGAGGACCAGAGTTAACAAAGAGATTGC
AAGGTACAAAAGAAAGCTACTCATAAATGACTTTGGAAGAGAGAGAAAATCGTCATCAGGAAGT
TCTGATTCAAAGGAGTCTGTGTCTTCAGTGCCTGCTGACGTGGAGACAGATGAAAGTGTCTTGA
TGAGAAGGCAGAAGCAGATCAACTATGGGAAGAACACTATGGCCTATGATCGATACATTAAAGA
GGTGCCCAGACACCTGCGACAGCCTGGAATCCATCCCAGGACCCCCAACAAATTTAAGAAGTAT
AGCCGGCGGTCATGGGACCAGCAGATCAAACTCTGGAAGGTGGCTTTGCATTTTTGGGATCCTC
CTGCTGAAGAAGGGTGTGATTTGCAAGAAATACAACCTGTAGATCTTGGGGAAATGGAGACAGA
ATTCACAGAAAGCAGCTCTGAGTCCCAGACAAGTTCACAGGATAACTTTGATGTATATGCTGGC
ACACCCACCAAAGTCAGACATGTGGACTGCCAAGTGGAGGACGAGTTTGATTTGGAAGCTTGTT
TAACTGAACCTTTGAAAGACTTCTCTGCCATGAGTTAACTGCCCCCTGGTGGTTACTCTGAGAA
ATACTTGGCTCTGCCTGGCTGCCTGGAAGGCATGAGTTGCTGTGCATTTGTATTTGTTTTCTCT
GTTAAGAATTTATTTTCTCATGATAAATAGTTTTTCTTGCCTTATTTTTATGTATGGTGAATGT
GTTACGCATGTTTTAAATTGTAAATGAAGCTGAATCCAGTGAAGACTTAACCCTATTACCTTTC
TGCCTCCTAAGTTAGACAACAGGATGCGTGTGGTTTTCTACCAGAACTTGGGACTCCAGCTACC
ACGTTTCAAATGGGTTGGCCACGGATTTTAACCGTGTGTTTATGGGACCAATTTAGAATTGGCT
GCCCTTTAGGTAACTGATGAAGAATTCTCAGTCAGGCAGCTGCAGTGACTTTGTAAAAACTTAT
TTTCTGGTCTTTTATCAATGTGAATGTAGCTTTCCCTCATACAGAGCTCTGAGCAAAGATGTTA
AGCTGTTATATTAATGGGCTTTTATGTAAGTTATATAGTTTTAATTTGGAACTTGAAATAGCAT
TAGTGTGAGGTAAGTATTTTAGTAAATGCTCTGTGAGTTGATGCAGAAGAGAGGAAGAGAGGGA
TTTAGAAAGAACTTTGTTTTTTTTTTTTTTTTTTAATGATCAGTTAATTTACCATGTAATATTG
CTGTAAATGATGTGTACAGATAACTCTGTTCATGTATTCAATTGTAAACTTGTCAATATTTGCA
TTTCTATTGCTTTTGTATGGAATGATAATTGCAAAAATAAAGATGCTTTAACTGATAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039092440 ⟹ XP_038948368

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	81,295,479 - 81,306,446 (+)	NCBI
mRatBN7.2	14	77,071,441 - 77,081,911 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001124460	(Get FASTA)	NCBI Sequence Viewer
	XP_038948368	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67755	(Get FASTA)	NCBI Sequence Viewer
	EDM00121	(Get FASTA)	NCBI Sequence Viewer
	EDM00123	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000047799
	ENSRNOP00000047799.3
	ENSRNOP00000093876.1

RefSeq Acc Id:

NP_001124460 ⟸ NM_001130988

- UniProtKB:

B3DM97 (UniProtKB/TrEMBL), D3ZSM2 (UniProtKB/TrEMBL), A0A9K3Y6R4 (UniProtKB/TrEMBL), A0A8I6AID5 (UniProtKB/TrEMBL), A6IK58 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MACRPRSPPRYGSRRDGGASPRSPARWSLGRKRRADGRDRKPEDSEEGELQTADHRPESFTTPE
GHKPRSRCSDWASAVEEDEMRTRVNKEIARYKRKLLINDFGRERKSSSGSSDSKESVSSVPADV
ETDESVLMRRQKQINYGKNTMAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSWDQQIKLWKV
ALHFWDPPAEEGCDLQEIQPVDLGEMETEFTESSSESQTSSQDNFDVYAGTPTKVRHVDCQVED
EFDLEACLTEPLKDFSAMS

hide sequence

Ensembl Acc Id:

ENSRNOP00000047799 ⟸ ENSRNOT00000040229

RefSeq Acc Id:	XP_038948368 ⟸ XM_039092440
- Peptide Label:	isoform X1
- UniProtKB:	A6IK59 (UniProtKB/TrEMBL), A0A8I6AID5 (UniProtKB/TrEMBL), A6IK58 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000093876 ⟸ ENSRNOT00000096081

Protein Domains

Histone RNA hairpin-binding protein RNA-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B3DM97-F1-model_v2	AlphaFold	B3DM97	1-275	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699410

Promoter ID:

EPDNEW_R9935

Type:

multiple initiation site

Name:

Slbp_1

Description:

stem-loop binding protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	82,356,891 - 82,356,951	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1584682	AgrOrtholog
BioCyc Gene	G2FUF-15260	BioCyc
Ensembl Genes	ENSRNOG00000037162	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000040229	ENTREZGENE
	ENSRNOT00000040229.5	UniProtKB/TrEMBL
	ENSRNOT00000096081.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.8.1120	UniProtKB/TrEMBL
InterPro	SLBP1/SLBP2	UniProtKB/TrEMBL
	SLBP_RNA_bind	UniProtKB/TrEMBL
	SLBP_RNA_bind_sf	UniProtKB/TrEMBL
KEGG Report	rno:681062	UniProtKB/TrEMBL
NCBI Gene	681062	ENTREZGENE
PANTHER	HISTONE RNA HAIRPIN-BINDING PROTEIN	UniProtKB/TrEMBL
	PTHR17408	UniProtKB/TrEMBL
Pfam	SLBP_RNA_bind	UniProtKB/TrEMBL
PhenoGen	Slbp	PhenoGen
RatGTEx	ENSRNOG00000037162	RatGTEx
UniProt	A0A8I6AID5	ENTREZGENE, UniProtKB/TrEMBL
	A0A9K3Y6R4	ENTREZGENE, UniProtKB/TrEMBL
	A6IK58	ENTREZGENE, UniProtKB/TrEMBL
	A6IK59	ENTREZGENE, UniProtKB/TrEMBL
	B3DM97	ENTREZGENE, UniProtKB/TrEMBL
	D3ZSM2	ENTREZGENE
UniProt Secondary	D3ZSM2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-07-25	Slbp	stem-loop histone mRNA binding protein	Slbp	stem-loop binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Slbp	stem-loop binding protein	LOC681062	similar to stem-loop binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC681062	similar to stem-loop binding protein	LOC682588	similar to stem-loop binding protein	Data merged from RGD:1597889	1643240	APPROVED
2006-11-20	LOC682588	similar to stem-loop binding protein			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC681062	similar to stem-loop binding protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD