Advanced Search (OLGA)

Gene: Scrt2 (scratch family transcriptional repressor 2) Rattus norvegicus

Analyze

Symbol:

Scrt2

Name:

scratch family transcriptional repressor 2

RGD ID:

1564796

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of DNA-templated transcription. Predicted to act upstream of or within negative regulation of transcription by RNA polymerase II and regulation of neuron migration. Predicted to be located in nucleus. Orthologous to human SCRT2 (scratch family transcriptional repressor 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

INFERRED

Previously known as:

LOC366229; RGD1564796; scratch family zinc finger 2; scratch homolog 2, zinc finger protein; scratch homolog 2, zinc finger protein (Drosophila); similar to Transcriptional repressor scratch 2 (Scratch homolog 2 zinc finger protein); transcriptional repressor scratch 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SCRT2 (scratch family transcriptional repressor 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	Scrt2 (scratch family zinc finger 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Scrt2 (scratch family transcriptional repressor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SCRT2 (scratch family transcriptional repressor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SCRT2 (scratch family transcriptional repressor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Scrt2 (scratch family transcriptional repressor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SCRT2 (scratch family transcriptional repressor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SCRT2 (scratch family transcriptional repressor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Scrt2 (scratch family transcriptional repressor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Scrt2 (scratch family transcriptional repressor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SCRT2 (scratch family transcriptional repressor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Scrt2 (scratch family zinc finger 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	scrt2 (scratch family zinc finger 2)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	scrt2 (scratch family zinc finger 2)	Alliance	DIOPT (OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG12605	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ces-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ces-1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CRZ1	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Drosophila melanogaster (fruit fly):	scrt	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Kah	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	scrt2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	scrt2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	161,041,651 - 161,055,596 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	161,041,651 - 161,055,596 (+)	Ensembl				GRCr8
mRatBN7.2	3	140,581,336 - 140,595,273 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,581,593 - 140,593,299 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	144,486,087 - 144,497,797 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,069,908 - 153,081,616 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,810,398 - 150,822,105 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,585,947 - 147,602,343 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,585,947 - 147,597,660 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	153,934,774 - 153,946,926 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	142,434,272 - 142,445,984 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	139,334,894 - 139,345,992 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

Aflatoxin B2 alpha (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

CGP 52608 (ISO)

methamphetamine (EXP)

niclosamide (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

potassium dichromate (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

titanium dioxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of transcription by RNA polymerase II (ISO)

regulation of DNA-templated transcription (IBA)

regulation of neuron migration (ISO)

Cellular Component

nucleus (ISO)

Molecular Function

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

metal ion binding (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific double-stranded DNA binding (IEA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:23434913

Genomics

Comparative Map Data

Scrt2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	161,041,651 - 161,055,596 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	161,041,651 - 161,055,596 (+)	Ensembl				GRCr8
mRatBN7.2	3	140,581,336 - 140,595,273 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,581,593 - 140,593,299 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	144,486,087 - 144,497,797 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,069,908 - 153,081,616 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,810,398 - 150,822,105 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,585,947 - 147,602,343 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,585,947 - 147,597,660 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	153,934,774 - 153,946,926 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	142,434,272 - 142,445,984 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	139,334,894 - 139,345,992 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

SCRT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	661,596 - 675,802 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	661,596 - 675,802 (-)	Ensembl			hg38	GRCh38
GRCh37	20	642,240 - 656,446 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	590,240 - 604,823 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	20	590,240 - 604,823	NCBI
Celera	20	737,069 - 751,655 (-)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	593,564 - 608,129 (-)	NCBI		HuRef
CHM1_1	20	642,279 - 656,827 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	705,869 - 720,058 (-)	NCBI		T2T-CHM13v2.0

Scrt2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	151,923,737 - 151,937,722 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	151,923,449 - 151,937,722 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	152,081,529 - 152,095,802 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	152,081,529 - 152,095,802 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	151,907,265 - 151,921,538 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	151,770,419 - 151,787,243 (+)	NCBI		MGSCv36	mm8
Celera	2	157,866,976 - 157,911,742 (+)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.83	NCBI

Scrt2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955597	504,160 - 515,581 (-)	Ensembl
ChiLan1.0	NW_004955597	504,160 - 515,609 (-)	NCBI	ChiLan1.0	ChiLan1.0

SCRT2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	1,752,288 - 1,766,538 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	1,749,116 - 1,763,378 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	872,121 - 886,773 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SCRT2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	24	19,859,971 - 19,872,419 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	20,898,529 - 20,910,978 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	20,898,979 - 20,910,966 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	20,173,836 - 20,186,277 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	20,279,591 - 20,292,019 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	20,710,437 - 20,722,875 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Scrt2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	169,432,655 - 169,435,128 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	17,863,644 - 17,864,486 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	17,812,995 - 17,866,492 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SCRT2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	34,558,048 - 34,571,168 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	34,558,247 - 34,570,434 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	39,399,981 - 39,402,288 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SCRT2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	55,842,754 - 55,856,777 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	55,842,875 - 55,854,708 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666078	8,096,415 - 8,110,381 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Scrt2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	1,756,746 - 1,769,161 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624741	1,755,596 - 1,769,298 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Scrt2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	131,438,667 - 131,451,039 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Scrt2
194 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	116
Count of miRNA genes:	91
Interacting mature miRNAs:	95
Transcripts:	ENSRNOT00000006833
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	141555229	186555229	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141555229	186555229	Rat
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	141555229	186555229	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	141555229	186555229	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	151075912	189428310	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	141555229	186555229	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	141555229	186555229	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1582213	Insul6	Insulin level QTL 6	3.7	0.0009	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	141508991	166376254	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	152055202	189428310	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	142898802	187898802	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	145335553	189428310	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	117537367	162537367	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
1582256	Insul9	Insulin level QTL 9	4.4	0.0016	blood insulin amount (VT:0001560)	absolute change in serum insulin level (CMO:0002038)	3	155759447	189428310	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	139299381	184299381	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	122395989	167395989	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	141508991	177728348	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	137114333	182114333	Rat
1582248	Insul7	Insulin level QTL 7	3.9	0.0041	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	151075912	189428310	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	151075912	189428310	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	141555229	186555229	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	144575244	189428310	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	160357340	167835660	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	116188400	161188400	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
6	2	12	138	44	38	22	21	22	6	82	48	2	122	4	30	16	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006833 ⟹ ENSRNOP00000006833

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	161,041,746 - 161,054,621 (+)	Ensembl
mRatBN7.2 Ensembl	3	140,581,593 - 140,593,299 (+)	Ensembl
Rnor_6.0 Ensembl	3	147,585,947 - 147,597,660 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000152808 ⟹ ENSRNOP00000107454

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	161,041,651 - 161,055,596 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000171988 ⟹ ENSRNOP00000110390

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	161,041,651 - 161,054,621 (+)	Ensembl

RefSeq Acc Id:

NM_001191905 ⟹ NP_001178834

RefSeq Status:

INFERRED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,041,651 - 161,055,596 (+)	NCBI
mRatBN7.2	3	140,581,336 - 140,595,273 (+)	NCBI
Rnor_6.0	3	147,585,947 - 147,597,660 (+)	NCBI
Rnor_5.0	3	153,934,774 - 153,946,926 (+)	NCBI
Celera	3	139,334,894 - 139,345,992 (+)	NCBI

Sequence:

show sequence

ATGCCGCGTTCCTTCCTGGTGAAGAAGATCAAAGCGGATGGCTTCCAGTGCAGCGGGGTGCCAG
CCCCCACCTACCACCCCCTGGAGACTGCCTACGTGCTGCCCGGTACCCGCGGGCCTCCGGGGGA
CAACGGTTATGTGGCGCACTGCATGCCCCCCAGCGGTTATGATGGCGAGCAGAAGCCTGGGCTG
GAGCTGGCGCCCACAGAGCCCGCCTACCCGGCCGCGGCGTCCGAGGAGTACAGCGACCCCGAGA
GCCCACAGTCCAGCCTGTCGGCGCGCTACTTCCGCGGGGAGGCGGCCGTGACCGACAGCTACTC
CATGGACGCCTTCTTCATTTCTGATGGGCGTTCGCGGCGGCGCCGGGCCGGGGCTGGCGGGGAC
GCGGCAGGCGCAGGGGATGGGGGCGGCGGCGGGGAGCGCGCGGGGCGCTCGGGGGCGACGGCGG
GAGGCGGGCACCGGCACGCATGCGCAGAGTGCGGCAAGACGTACGCCACGTCGTCGAACCTGAG
CCGCCACAAGCAGACGCACCGCAGCCTGGACAGCCAGCTGGCGCGCAAGTGCCCGACGTGTGGC
AAGGCCTACGTGTCTATGCCCGCGCTCGCCATGCACGTGCTCACGCACAACCTGCGCCACAAGT
GCGGCGTGTGCGGCAAGGCCTTCTCCCGGCCCTGGTTGCTCCAGGGCCACATGCGCTCGCACAC
CGGCGAGAAGCCCTTTGGTTGCGCGCACTGCGGCAAGGCCTTCGCCGACCGCTCCAACCTGCGC
GCGCACATGCAGACGCACTCGGCCTTCAAGCACTACCGCTGCCGCCAGTGCGACAAGAGCTTCG
CGCTCAAGTCCTACCTCCACAAGCACTGCGAGGCTGCCTGCGTGAAGGCCGCCGAGCCTCCGCC
TTCCGCCGGCCCGGCCAGCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001178834	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL86085	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006833.4
	ENSRNOP00000107454
	ENSRNOP00000107454.1
	ENSRNOP00000110390.1

RefSeq Acc Id:

NP_001178834 ⟸ NM_001191905

- UniProtKB:

D3ZNS5 (UniProtKB/TrEMBL), A6KHM0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPRSFLVKKIKADGFQCSGVPAPTYHPLETAYVLPGTRGPPGDNGYVAHCMPPSGYDGEQKPGL
ELAPTEPAYPAAASEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAFFISDGRSRRRRAGAGGD
AAGAGDGGGGGERAGRSGATAGGGHRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCG
KAYVSMPALAMHVLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLR
AHMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACVKAAEPPPSAGPAS

hide sequence

Ensembl Acc Id:

ENSRNOP00000006833 ⟸ ENSRNOT00000006833

Ensembl Acc Id:

ENSRNOP00000110390 ⟸ ENSRNOT00000171988

Ensembl Acc Id:

ENSRNOP00000107454 ⟸ ENSRNOT00000152808

Protein Domains

C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZNS5-F1-model_v2	AlphaFold	D3ZNS5	1-305	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564796	AgrOrtholog
BioCyc Gene	G2FUF-47282	BioCyc
Ensembl Genes	ENSRNOG00000005148	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006833.5	UniProtKB/TrEMBL
	ENSRNOT00000152808	ENTREZGENE
	ENSRNOT00000152808.1	UniProtKB/TrEMBL
	ENSRNOT00000171988.1	UniProtKB/TrEMBL
Gene3D-CATH	Classic Zinc Finger	UniProtKB/TrEMBL
InterPro	Snail/Krueppel_Znf	UniProtKB/TrEMBL
	Znf_C2H2/integrase_DNA-bd	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
KEGG Report	rno:366229	UniProtKB/TrEMBL
NCBI Gene	366229	ENTREZGENE
PANTHER	TRANSCRIPTIONAL REPRESSOR SCRATCH 2	UniProtKB/TrEMBL
	ZINC FINGER PROTEIN	UniProtKB/TrEMBL
Pfam	zf-C2H2	UniProtKB/TrEMBL
	zf-C2H2_6	UniProtKB/TrEMBL
PhenoGen	Scrt2	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005148	RatGTEx
SMART	ZnF_C2H2	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57667	UniProtKB/TrEMBL
UniProt	A0ABK0LNM4_RAT	UniProtKB/TrEMBL
	A0ABK0LYN3_RAT	UniProtKB/TrEMBL
	A6KHM0	ENTREZGENE, UniProtKB/TrEMBL
	D3ZNS5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-11	Scrt2	scratch family transcriptional repressor 2	Scrt2	scratch family zinc finger 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-11-11	Scrt2	scratch family zinc finger 2	Scrt2	scratch homolog 2, zinc finger protein (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Scrt2	scratch homolog 2, zinc finger protein (Drosophila)	RGD1564796_predicted	similar to Transcriptional repressor scratch 2 (Scratch homolog 2 zinc finger protein) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-10	RGD1564796_predicted	similar to Transcriptional repressor scratch 2 (Scratch homolog 2 zinc finger protein) (predicted)			Name updated	1299863	APPROVED
2006-03-07	RGD1564796_predicted	similar to Transcriptional repressor scratch 2 (Scratch homolog 2 zinc finger protein) (predicted)	LOC366229	similar to Transcriptional repressor scratch 2 (Scratch homolog 2 zinc finger protein)	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC366229	similar to Transcriptional repressor scratch 2 (Scratch homolog 2 zinc finger protein)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message