Advanced Search (OLGA)

Gene: Eid1 (EP300 interacting inhibitor of differentiation 1) Rattus norvegicus

Analyze

Symbol:

Eid1

Name:

EP300 interacting inhibitor of differentiation 1

RGD ID:

1562702

Description:

Predicted to enable histone acetyltransferase binding activity and transcription corepressor activity. Predicted to be involved in cell differentiation and negative regulation of DNA-templated transcription. Predicted to act upstream of or within negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be active in nucleoplasm. Orthologous to human EID1 (EP300 interacting inhibitor of differentiation 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

EP300-interacting inhibitor of differentiation 1; LOC499882; RGD1562702; similar to CREBBP/EP300 inhibitory protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	133,376,389 - 133,378,108 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	133,370,474 - 133,378,434 (+)	Ensembl				GRCr8
mRatBN7.2	3	112,922,961 - 112,924,680 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	112,922,668 - 112,924,752 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	116,788,425 - 116,790,142 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	125,383,940 - 125,385,657 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	123,044,306 - 123,046,023 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	117,938,500 - 117,940,219 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	117,938,500 - 117,940,219 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	124,462,726 - 124,464,445 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	112,979,189 - 112,980,908 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	111,778,100 - 111,779,819 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Mesothelioma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bilirubin IXalpha (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

choline (ISO)

cobalt dichloride (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

diuron (ISO)

doxorubicin (ISO)

endosulfan (EXP)

fluoranthene (ISO)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

gold atom (ISO)

gold(0) (ISO)

GSK-J4 (ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

inulin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

methapyrilene (EXP)

methimazole (EXP)

nickel dichloride (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

sarin (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

torcetrapib (ISO)

trichloroethene (EXP,ISO)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA,ISO)

DNA-templated transcription (IEA)

negative regulation of DNA-templated transcription (IBA,ISO)

negative regulation of transcription by RNA polymerase II (ISO)

Cellular Component

nucleoplasm (IBA,ISO)

nucleus (IEA)

Molecular Function

histone acetyltransferase binding (ISO)

protein binding (ISO)

transcription corepressor activity (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11073989	PMID:11073990	PMID:11964378	PMID:12477932

Genomics

Comparative Map Data

Eid1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	133,376,389 - 133,378,108 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	133,370,474 - 133,378,434 (+)	Ensembl				GRCr8
mRatBN7.2	3	112,922,961 - 112,924,680 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	112,922,668 - 112,924,752 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	116,788,425 - 116,790,142 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	125,383,940 - 125,385,657 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	123,044,306 - 123,046,023 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	117,938,500 - 117,940,219 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	117,938,500 - 117,940,219 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	124,462,726 - 124,464,445 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	112,979,189 - 112,980,908 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	111,778,100 - 111,779,819 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

EID1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	48,878,134 - 48,880,173 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	48,878,134 - 48,880,173 (+)	Ensembl			hg38	GRCh38
GRCh37	15	49,170,331 - 49,172,370 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	46,957,582 - 46,959,672 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	46,957,581 - 46,959,672	NCBI
Celera	15	26,063,920 - 26,066,010 (+)	NCBI		Celera
Cytogenetic Map	15	q21.1	NCBI
HuRef	15	26,002,299 - 26,004,389 (+)	NCBI		HuRef
CHM1_1	15	49,288,315 - 49,290,405 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	46,686,343 - 46,688,382 (+)	NCBI		T2T-CHM13v2.0

Eid1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	125,515,020 - 125,517,563 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	125,515,015 - 125,516,705 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	125,673,100 - 125,675,643 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	125,673,095 - 125,674,785 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	125,498,836 - 125,501,379 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	125,364,536 - 125,366,224 (+)	NCBI		MGSCv36	mm8
Celera	2	126,918,629 - 126,921,172 (+)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	61.76	NCBI

Eid1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	5,067,089 - 5,067,658 (-)	Ensembl
ChiLan1.0	NW_004955409	5,066,042 - 5,067,747 (-)	NCBI	ChiLan1.0	ChiLan1.0

EID1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	38,119,277 - 38,121,185 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	42,303,384 - 42,305,107 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	27,827,790 - 27,829,493 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	46,150,806 - 46,153,017 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

EID1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	15,108,957 - 15,110,849 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	15,109,164 - 15,109,739 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	15,030,495 - 15,032,381 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	15,242,721 - 15,244,613 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	15,242,221 - 15,243,502 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	15,166,045 - 15,167,935 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	15,287,057 - 15,288,951 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	15,393,592 - 15,395,485 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Eid1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	93,350,029 - 93,351,742 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	11,198,171 - 11,198,746 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	11,198,094 - 11,199,805 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EID1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	122,811,556 - 122,812,131 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	122,810,484 - 122,812,481 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	136,635,408 - 136,637,406 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EID1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	34,412,053 - 34,413,645 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	34,413,000 - 34,413,566 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	106,714,218 - 106,716,465 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eid1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624731	10,839,351 - 10,841,122 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Eid1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	104,004,078 - 104,005,845 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Eid1
4 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	176
Count of miRNA genes:	145
Interacting mature miRNAs:	155
Transcripts:	ENSRNOT00000042411
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	96509147	141509147	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	122654702	136118980	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	116582412	136118980	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	85062224	136118980	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	85062224	136118980	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	104545086	149545086	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	93829559	138829559	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	112250810	157250810	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	101255536	134750886	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	96509147	141509147	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	117537367	162537367	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	110225882	155225882	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	90755164	141509147	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	122395989	167395989	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	125814931	139636791	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	110634702	155634702	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	116188400	161188400	Rat

Markers in Region

BE107507

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	112,924,072 - 112,924,225 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	117,939,612 - 117,939,764	NCBI	Rnor6.0
Rnor_5.0	3	124,463,838 - 124,463,990	UniSTS	Rnor5.0
RGSC_v3.4	3	112,980,301 - 112,980,453	UniSTS	RGSC3.4
Celera	3	111,779,212 - 111,779,364	UniSTS
RH 3.4 Map	3	984.5	UniSTS
Cytogenetic Map	3	q36	UniSTS

RH139161

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	112,924,500 - 112,924,635 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	117,940,040 - 117,940,174	NCBI	Rnor6.0
Rnor_5.0	3	124,464,266 - 124,464,400	UniSTS	Rnor5.0
RGSC_v3.4	3	112,980,729 - 112,980,863	UniSTS	RGSC3.4
Celera	3	111,779,640 - 111,779,774	UniSTS
RH 3.4 Map	3	985.3	UniSTS
Cytogenetic Map	3	q36	UniSTS

RH129470

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	112,924,463 - 112,924,646 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	117,940,003 - 117,940,185	NCBI	Rnor6.0
Rnor_5.0	3	124,464,229 - 124,464,411	UniSTS	Rnor5.0
RGSC_v3.4	3	112,980,692 - 112,980,874	UniSTS	RGSC3.4
Celera	3	111,779,603 - 111,779,785	UniSTS
RH 3.4 Map	3	985.3	UniSTS
Cytogenetic Map	3	q36	UniSTS

BI281881

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	133,377,499 - 133,377,653 (+)	Marker Load Pipeline
mRatBN7.2	3	112,924,071 - 112,924,225 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	117,939,611 - 117,939,764	NCBI	Rnor6.0
Rnor_5.0	3	124,463,837 - 124,463,990	UniSTS	Rnor5.0
RGSC_v3.4	3	112,980,300 - 112,980,453	UniSTS	RGSC3.4
Celera	3	111,779,211 - 111,779,364	UniSTS
RH 3.4 Map	3	984.5	UniSTS
Cytogenetic Map	3	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC162030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212865	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213443	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000042411 ⟹ ENSRNOP00000061705

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	133,370,474 - 133,378,434 (+)	Ensembl
mRatBN7.2 Ensembl	3	112,922,668 - 112,924,752 (+)	Ensembl
Rnor_6.0 Ensembl	3	117,938,500 - 117,940,219 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000169324 ⟹ ENSRNOP00000099069

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	133,370,624 - 133,378,434 (+)	Ensembl

RefSeq Acc Id:

NM_001109205 ⟹ NP_001102675

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	133,376,389 - 133,378,108 (+)	NCBI
mRatBN7.2	3	112,922,961 - 112,924,680 (+)	NCBI
Rnor_6.0	3	117,938,500 - 117,940,219 (+)	NCBI
Rnor_5.0	3	124,462,726 - 124,464,445 (+)	NCBI
RGSC_v3.4	3	112,979,189 - 112,980,908 (+)	RGD
Celera	3	111,778,100 - 111,779,819 (+)	RGD

Sequence:

show sequence

ACGCGCGCCACGCACGCCCTCTTGCCTGCGCACGCGCACCACACCCGTTCGCGCGCCCGTCTCT
GCAAAAGGTGTATTTTTTCGTGGCTGAGTTGCTTCCACCATGGCGGAGATGGCAGAGCTTTGCG
AGCTGTACGAAGAAAGCAACGAGCTGCAGATGGACGTGCTGCCCGGCGAGGGCGATATGGAGGT
AGGCCGCGGAGCCCGCGGGCCGGCCCCGGAGGAGGGCCCCATGGAGGAGGAGGCCGGGCCGTCC
GCCGCCCGCGCCCAGCGCGGCCTCTTCCCCGAGGCTGGCGCGGACCTAGAAGGCGACGAGTTTG
ATGATTGGGAGGACGACTATGACTTCCCTGAAGAGGAGCGCTGGAGTGGCGCGATGCACAGGGT
GTCCGCTGCGCTGGAGGAAGCCAACAAGGTGTTCCTGCGAACGGCGCAAGCCGGTGATGCCCTG
GATGGCGGGTTTCAGGCGCGCTGCGAGAAGAGCCCTTTCGACCAGCTAGCTTTTATCGAAGAGC
TGTTTTCGCTGATGGTTGTCAATCGACTGACCGAAGAGCTCGGTTGTGATGAGATCATTGATCG
AGAGTAAATGCTGATGAAAGAGGAGGAAACTACCTGAGAGGGAGAGATTCAACATTCTGCTATT
TTGGGGTTCATTCCAAATAGTTCTGTGCAAAAAATAAAAACAGTTGGTTTTTGTTTCTCGGAAT
AGAAGACAGGACAGTGAATGAATAACCGTGCATTGTGGAAAAGGAGAATCAAGAAAGGAGGAGT
GTTAAACCTGAGAATCGCAAGGAGAAAAGACCAAAAGTGTTCCTTGTTTGGTCTCACAGGGCCT
CAGCAAAAACCTCTGGTTCAGACTGTTGATCGAGATGATTTCCCTTACATTGGAGAAGAACTTT
CTCGTGTTAAGCTTTTGAAGATGATTTGAAAGAGTAAATTATGACTGCCAATACAAGAATCTAA
TTAAAGAATGAGGAAAAAAAATACATCCACAAGATATCTTTGATTTGAACTAAAAGGCTATTGA
AAAAAACTTTGTAAATTCTTCTTTATGGTTTATACACATCTAGTTATCAAAAGCAAAATTTGAG
GTTTAAGATTGAGCATTCATCAACCCCAGAGGGTAGTCAAAGTAAATGTGTGTGTAAATGTAGA
CGTGTTACCAGGTGTACTATCCTCTTAAAACGTGTTACAAAAGCTGGGATTGTGACTGCACATG
CATCTTCATGATTTATAAAGCTACTGTGGTCCCTGATCTATTGTGATGACTTATAAAGTAAAGA
AAAAAAAGGATGTCTTTTTAAGGTTTTAAGTTCGTGCATTAAATAAAATGTATGGGAAAGCCCA
AAGACAAAGTTTCTAATACCCTTTTATACTAGGGAAATTTCGCTTGCTGTTTTTTTGGGTTTTT
TTTTGTTTTTGTTTTTTTTTTTTTTTACCTTGACAGATGGTAAGAGTATAACTGACGTTCATAT
TGTAAGAAGTGTTTGCAAAAGTTGTCAAGTAAAAGGAAACCCTACCTGTATCTAGAAAAGATTT
TTGAGCTCTTATGCTGTCAAACTTGGAAGATTTTAAACCTACCCAGAAGTCCACCTGGGTGCTT
GATACTCATGTTCTCTCCCTCTCTCCCTCTCTGCCTCTTTCTTCCCTTCCCCCTCCCTCCTGAT
TTGCTTGTTACTCTTGATGCACCAGCATTGGCGATAATAAATTTTCTCGTTCTGAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102675	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI62030	(Get FASTA)	NCBI Sequence Viewer
	EDL80076	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061705
	ENSRNOP00000061705.1
	ENSRNOP00000099069.1

RefSeq Acc Id:	NP_001102675 ⟸ NM_001109205
- UniProtKB:	B1WC74 (UniProtKB/TrEMBL), F7FHN0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAEMAELCELYEESNELQMDVLPGEGDMEVGRGARGPAPEEGPMEEEAGPSAARAQRGLFPEAG ADLEGDEFDDWEDDYDFPEEERWSGAMHRVSAALEEANKVFLRTAQAGDALDGGFQARCEKSPF DQLAFIEELFSLMVVNRLTEELGCDEIIDRE hide sequence

Ensembl Acc Id:

ENSRNOP00000061705 ⟸ ENSRNOT00000042411

Ensembl Acc Id:

ENSRNOP00000099069 ⟸ ENSRNOT00000169324

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WC74-F1-model_v2	AlphaFold	B1WC74	1-159	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692381

Promoter ID:

EPDNEW_R2906

Type:

initiation region

Name:

Eid1_1

Description:

EP300 interacting inhibitor of differentiation 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	117,938,540 - 117,938,600	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562702	AgrOrtholog
BioCyc Gene	G2FUF-48036	BioCyc
Ensembl Genes	ENSRNOG00000008452	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000042411	ENTREZGENE
	ENSRNOT00000042411.7	UniProtKB/TrEMBL
	ENSRNOT00000169324.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9100917	IMAGE-MGC_LOAD
InterPro	EID	UniProtKB/TrEMBL
KEGG Report	rno:499882	UniProtKB/TrEMBL
MGC_CLONE	MGC:187926	IMAGE-MGC_LOAD
NCBI Gene	499882	ENTREZGENE
PANTHER	PTHR15556	UniProtKB/TrEMBL
	PTHR15556:SF5	UniProtKB/TrEMBL
PhenoGen	Eid1	PhenoGen
RatGTEx	ENSRNOG00000008452	RatGTEx
UniProt	B1WC74	ENTREZGENE, UniProtKB/TrEMBL
	F7FHN0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-29	Eid1	EP300 interacting inhibitor of differentiation 1	RGD1562702_predicted	similar to CREBBP/EP300 inhibitory protein 1 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1562702_predicted	similar to CREBBP/EP300 inhibitory protein 1 (predicted)	LOC499882	similar to CREBBP/EP300 inhibitory protein 1	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499882	similar to CREBBP/EP300 inhibitory protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD