Advanced Search (OLGA)

Gene: Ccdc68 (coiled-coil domain containing 68) Rattus norvegicus

Analyze

Symbol:

Ccdc68

Name:

coiled-coil domain containing 68

RGD ID:

1561424

Description:

Predicted to be involved in intracellular protein localization and microtubule anchoring at centrosome. Predicted to be part of centriolar subdistal appendage. Predicted to be active in centriole. Orthologous to human CCDC68 (coiled-coil domain containing 68); INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

coiled-coil domain-containing protein 68; CTCL tumor antigen se57-1; LOC291530; RGD1561424; similar to CTCL tumor antigen se57-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCDC68 (coiled-coil domain containing 68)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ccdc68 (coiled-coil domain containing 68)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccdc68 (coiled-coil domain containing 68)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCDC68 (coiled-coil domain containing 68)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCDC68 (coiled-coil domain containing 68)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccdc68 (coiled-coil domain containing 68)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCDC68 (coiled-coil domain containing 68)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCDC68 (coiled-coil domain containing 68)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccdc68 (coiled-coil domain containing 68)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ccdc68 (coiled-coil domain containing 68)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CCDC150 (coiled-coil domain containing 150)	HGNC	PhylomeDB
Alliance orthologs ³
Homo sapiens (human):	CCDC68 (coiled-coil domain containing 68)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CCDC68 (coiled-coil domain containing 68)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccdc68 (coiled-coil domain containing 68)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccdc68 (coiled-coil domain containing 68)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccdc68	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccdc68	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	65,817,232 - 65,859,529 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	65,786,926 - 65,859,526 (+)	Ensembl				GRCr8
mRatBN7.2	18	63,541,828 - 63,584,122 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	63,541,896 - 63,584,119 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	65,632,130 - 65,674,399 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	66,310,463 - 66,352,696 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	64,192,155 - 64,234,401 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	68,408,812 - 68,472,323 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	68,408,890 - 68,472,320 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	67,564,633 - 67,626,014 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	66,623,573 - 66,665,814 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	61,636,522 - 61,676,187 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Habitual Abortions (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

acrolein (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dicrotophos (ISO)

dioxygen (EXP,ISO)

dorsomorphin (ISO)

endosulfan (EXP)

ethylparaben (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

glycidol (EXP)

L-methionine (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

methapyrilene (EXP,ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (ISO)

nickel sulfate (ISO)

niclosamide (ISO)

orphenadrine (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

progesterone (ISO)

quercetin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

tetraphene (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular protein localization (ISO)

microtubule anchoring at centrosome (IBA,ISO)

Cellular Component

centriolar subdistal appendage (ISO)

centriole (IBA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:28422092

Genomics

Comparative Map Data

Ccdc68
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	65,817,232 - 65,859,529 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	65,786,926 - 65,859,526 (+)	Ensembl				GRCr8
mRatBN7.2	18	63,541,828 - 63,584,122 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	63,541,896 - 63,584,119 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	65,632,130 - 65,674,399 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	66,310,463 - 66,352,696 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	64,192,155 - 64,234,401 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	68,408,812 - 68,472,323 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	68,408,890 - 68,472,320 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	67,564,633 - 67,626,014 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	66,623,573 - 66,665,814 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	61,636,522 - 61,676,187 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

CCDC68
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	54,901,509 - 54,959,461 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	54,901,504 - 54,959,519 (-)	Ensembl			hg38	GRCh38
GRCh37	18	52,568,740 - 52,626,692 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	50,719,791 - 50,777,635 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	18	49,286,315 - 49,344,306 (-)	NCBI		Celera
Cytogenetic Map	18	q21.2	NCBI
HuRef	18	49,277,953 - 49,335,856 (-)	NCBI		HuRef
CHM1_1	18	52,563,986 - 52,622,029 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	18	55,104,591 - 55,162,630 (-)	NCBI		T2T-CHM13v2.0

Ccdc68
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	70,057,929 - 70,102,559 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	70,058,497 - 70,102,555 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	69,924,858 - 69,969,488 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	69,925,426 - 69,969,484 (+)	Ensembl			mm10	GRCm38
MGSCv37	18	70,085,213 - 70,129,138 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	70,050,928 - 70,094,853 (+)	NCBI		MGSCv36	mm8
Celera	18	71,216,513 - 71,260,561 (+)	NCBI		Celera
Cytogenetic Map	18	E2	NCBI
cM Map	18	43.78	NCBI

Ccdc68
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	39,423,316 - 39,493,809 (-)	Ensembl
ChiLan1.0	NW_004955402	39,426,158 - 39,493,655 (-)	NCBI	ChiLan1.0	ChiLan1.0

CCDC68
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	72,426,763 - 72,484,388 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	58,108,866 - 58,177,003 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	48,280,443 - 48,337,823 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	51,616,129 - 51,660,189 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	51,616,129 - 51,658,312 (-)	Ensembl			panPan2	panpan1.1

CCDC68
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	20,644,302 - 20,688,615 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	20,656,190 - 20,687,998 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	21,623,176 - 21,674,467 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	20,524,860 - 20,576,165 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	20,539,287 - 20,576,143 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	20,578,407 - 20,629,637 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	20,473,432 - 20,524,590 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	20,745,160 - 20,796,344 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ccdc68
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	33,751,766 - 33,795,620 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936497	9,005,157 - 9,034,486 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936497	8,990,841 - 9,035,498 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCDC68
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	104,424,001 - 104,474,489 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	104,424,413 - 104,474,581 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	114,765,620 - 114,802,011 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCDC68
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	24,746,806 - 24,803,950 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666060	735,254 - 791,257 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccdc68
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624792	378,711 - 446,932 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624792	375,934 - 541,040 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ccdc68
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	61,298,152 - 61,325,717 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ccdc68
246 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	51
Count of miRNA genes:	42
Interacting mature miRNAs:	50
Transcripts:	ENSRNOT00000039702
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	54490801	86134022	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	64383762	79484311	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	53350521	68120379	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	38575919	83575919	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26822186	71822186	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26822186	71822186	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26822186	71822186	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	45620306	86134022	Rat
7794793	Mcs34	Mammary carcinoma susceptibility QTL 34	1.54		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	18	65635567	85897775	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26822186	71822186	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	48915737	86134022	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	48915737	86134022	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26822186	71822186	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26822186	71822186	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	31990891	76990891	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	45620306	86134022	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	61982204	76619168	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31610505	85493247	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	33379158	78379158	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	61446853	86134022	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	40462383	85462383	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	54490801	76272247	Rat
2312600	Bp341	Blood pressure QTL 341		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	61600384	72538878	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	31990891	76990891	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	54490801	68120379	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	33379158	78379158	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	33379158	78379158	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	33379158	78379158	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	50795212	86134022	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26822186	71822186	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31522783	76522783	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	33379158	78379158	Rat
61384	Bp48	Blood pressure QTL 48	19.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	62892257	79484461	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	33379158	78379158	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	33379158	78379158	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	57825243	85493247	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31610505	77371277	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	36121626	81121626	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	31990891	76990891	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	48915737	86134022	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	26415821	71415821	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31644508	79484311	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	65846447	86134022	Rat
1598832	Glom11	Glomerulus QTL 11	2.9		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	53266671	86134022	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	31990891	76990891	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	50795212	86134022	Rat
631675	Iddm15	Insulin dependent diabetes mellitus QTL 15			urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	18	62892257	79484461	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31610505	72538878	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	52198059	68120379	Rat

Markers in Region

D18Rat43

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	18	65,846,447 - 65,846,674 (+)	Marker Load Pipeline
mRatBN7.2	18	63,571,040 - 63,571,267 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	68,436,105 - 68,436,331	NCBI	Rnor6.0
Rnor_5.0	18	67,591,915 - 67,592,141	UniSTS	Rnor5.0
RGSC_v3.4	18	66,652,461 - 66,652,947	RGD	RGSC3.4
RGSC_v3.4	18	66,652,720 - 66,652,946	UniSTS	RGSC3.4
Celera	18	61,663,105 - 61,663,331	UniSTS
RGSC_v3.1	18	66,725,662 - 66,726,148	RGD
RH 3.4 Map	18	658.2	RGD
RH 3.4 Map	18	658.2	UniSTS
RH 2.0 Map	18	254.7	RGD
SHRSP x BN Map	18	38.8299	RGD
FHH x ACI Map	18	45.24	RGD
Cytogenetic Map	18	q12.1	UniSTS

BI278833

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	63,583,810 - 63,583,908 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	68,472,012 - 68,472,109	NCBI	Rnor6.0
Rnor_5.0	18	67,625,703 - 67,625,800	UniSTS	Rnor5.0
RGSC_v3.4	18	66,665,503 - 66,665,600	UniSTS	RGSC3.4
Celera	18	61,675,876 - 61,675,973	UniSTS
RH 3.4 Map	18	659.6	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	10	66	143	91	90	59	23	59	6	283	121	11	115	80	83	31	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001077667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001437393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001437395	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001437396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772113	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096659	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005495999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005496000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005496001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005496002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC127517	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000039702 ⟹ ENSRNOP00000029680

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	65,817,301 - 65,859,526 (+)	Ensembl
mRatBN7.2 Ensembl	18	63,541,896 - 63,584,119 (+)	Ensembl
Rnor_6.0 Ensembl	18	68,408,890 - 68,472,320 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097450 ⟹ ENSRNOP00000081447

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	65,817,301 - 65,859,526 (+)	Ensembl
mRatBN7.2 Ensembl	18	63,541,896 - 63,584,119 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110274 ⟹ ENSRNOP00000076540

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	65,817,302 - 65,859,526 (+)	Ensembl
mRatBN7.2 Ensembl	18	63,541,896 - 63,584,119 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000132289 ⟹ ENSRNOP00000108976

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	65,817,301 - 65,859,526 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000137769 ⟹ ENSRNOP00000105249

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	65,786,926 - 65,859,526 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000163618 ⟹ ENSRNOP00000103687

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	65,817,182 - 65,859,526 (+)	Ensembl

RefSeq Acc Id:

NM_001077667 ⟹ NP_001071135

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	65,817,301 - 65,859,529 (+)	NCBI
mRatBN7.2	18	63,541,896 - 63,584,122 (+)	NCBI
Rnor_6.0	18	68,408,890 - 68,472,323 (+)	NCBI
Rnor_5.0	18	67,564,633 - 67,626,014 (+)	NCBI
RGSC_v3.4	18	66,623,573 - 66,665,814 (+)	RGD
Celera	18	61,636,522 - 61,676,187 (+)	RGD

Sequence:

show sequence

GAGCACTTAGGTGCTCTCAGTCGCCAAACTTCAGCAGTTAAGGACCCGACGGTGGGCTCTCTGC
CAGATCGCTGGAACTGGAGCAGGCGGAGGCCTTCAAGCCAGAATTCACCATGACAACTGTCACG
GTGACCATGGAAGTTCCTTCTGGGGGTAAGACAGAAGACCGCTCCATCTTCAGTGGACCGTCGT
CAGCTCAGATTATTGAAGAAACTGAGTATGTGAGAAAGATTCGAACTACCCTGGAAAAGATCCG
GAATCGCATGTTTAAGGAGGAAGACGGCCGAGGCAATGCAAGGCACAAAGTAGATGCAGAGCAA
TCTGGAAATGTTCAGAATGGCTTGGATTCTACAACAGACCCCACCAGGTTGGATTTGCTCTTGG
AAAGCATGAGAAGAAAAGATCAGCAGCTCCTAGAAATGAACAAAGAAAACGAAGTGTTGCAAAT
CAAGCTGGAAGCTTCCCGAGAAGCAGGAGCGGCAGCTTTGAGAAATGCGGCTCAGAGATTATTT
GACAACTACCAAACGCAGTCTGAAGACCTGGAGAAAAAGCATAAGGACAGTAAACATGTACTTC
AGGTCAACAAACTCGAGAAAGAGCAGACGTTAAAGCAACGTGCCAAAAATCTGAGTCAACTTTC
AGAAAAACTGGGAGAAAAACATGAGCAAATCGTAGGACTGGAAAACCGTGTCCAGAGGATGGAA
AATATGGAAGGACTAAAAAATACTTTAAAGGAACAAGATAAAAAAATTGAAAATTTGAAAGAAA
AGGTCACCGTGCTCGAAGCCCAGAATGAAGAACTAAAAACCAAGGTGGCACACTGGACGGAATC
TCCTAGGACATCAGTATCTAAGGCCGTCTCTACAAGTGAGTTGAAGACTGAAGGTGCTTCTCCC
TATTTGATGTTGATTCGGCTACGAAAATGAGCTGGCTGGCTGCAGTTCTGACAGAGAAGGACTT
CTACAGATTTTATTTATTCCTTGAAATACAGTTTCAGCTCCCAAGTTAAAGTGACATCATGTCT
TATCTAAATGTAACTTAGTATACATCAATAACGGCATAGAAAGGTGATATTGCAGGCAATTCAA
CAAATGTCTCCTGGAGAGAAGAAACCTTTTTCTTTTTAAACCAAAATGTAACTTAAAAGGCCAA
GGGACTAGGATCTTTCCCACATGGAAGATGAATTCTGCTTTAAACCTAAAATATTAAAATTTGA
ATCTATCTCTCTTCAAACATTTTACAAAGAGGACTCTTATAAGGTTGTCAGATTTGACCTTTGA
TAGTGGTTCTTATGTGTATAAATAAAGGGAAGTATGTAAATATATATTAATGAATGATGTAATT
TAATTTGGCATTTAGGTAATAAATATCTTACCATGCCACAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039096658 ⟹ XP_038952586

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	65,817,236 - 65,859,529 (+)	NCBI
mRatBN7.2	18	63,541,832 - 63,584,122 (+)	NCBI

RefSeq Acc Id:

XM_039096659 ⟹ XP_038952587

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	65,817,236 - 65,859,529 (+)	NCBI
mRatBN7.2	18	63,541,832 - 63,584,122 (+)	NCBI

RefSeq Acc Id:

XM_063277189 ⟹ XP_063133259

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	65,817,235 - 65,859,529 (+)	NCBI

RefSeq Acc Id:

XR_005495999

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	65,817,233 - 65,857,019 (+)	NCBI
mRatBN7.2	18	63,541,829 - 63,581,617 (+)	NCBI

RefSeq Acc Id:

XR_005496000

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	65,817,232 - 65,857,046 (+)	NCBI
mRatBN7.2	18	63,541,828 - 63,581,639 (+)	NCBI

RefSeq Acc Id:

XR_005496001

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	65,817,234 - 65,859,076 (+)	NCBI
mRatBN7.2	18	63,541,830 - 63,584,122 (+)	NCBI

RefSeq Acc Id:

XR_005496002

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	65,817,233 - 65,857,019 (+)	NCBI
mRatBN7.2	18	63,541,829 - 63,581,617 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001071135	(Get FASTA)	NCBI Sequence Viewer
	NP_001424322	(Get FASTA)	NCBI Sequence Viewer
	NP_001424324	(Get FASTA)	NCBI Sequence Viewer
	NP_001424325	(Get FASTA)	NCBI Sequence Viewer
	XP_038952586	(Get FASTA)	NCBI Sequence Viewer
	XP_038952587	(Get FASTA)	NCBI Sequence Viewer
	XP_063133259	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI27518	(Get FASTA)	NCBI Sequence Viewer
	EDM14772	(Get FASTA)	NCBI Sequence Viewer
	EDM14773	(Get FASTA)	NCBI Sequence Viewer
	EDM14774	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000029680
	ENSRNOP00000029680.4
	ENSRNOP00000076540
	ENSRNOP00000076540.1
	ENSRNOP00000081447.1
	ENSRNOP00000103687
	ENSRNOP00000103687.1
	ENSRNOP00000105249.1
	ENSRNOP00000108976.1

RefSeq Acc Id:

NP_001071135 ⟸ NM_001077667

- UniProtKB:

A0JPN5 (UniProtKB/TrEMBL), A0A8I5ZSZ9 (UniProtKB/TrEMBL), A6IXZ2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTTVTVTMEVPSGGKTEDRSIFSGPSSAQIIEETEYVRKIRTTLEKIRNRMFKEEDGRGNARHK
VDAEQSGNVQNGLDSTTDPTRLDLLLESMRRKDQQLLEMNKENEVLQIKLEASREAGAAALRNA
AQRLFDNYQTQSEDLEKKHKDSKHVLQVNKLEKEQTLKQRAKNLSQLSEKLGEKHEQIVGLENR
VQRMENMEGLKNTLKEQDKKIENLKEKVTVLEAQNEELKTKVAHWTESPRTSVSKAVSTSELKT
EGASPYLMLIRLRK

hide sequence

Ensembl Acc Id:

ENSRNOP00000029680 ⟸ ENSRNOT00000039702

RefSeq Acc Id:	XP_038952586 ⟸ XM_039096658
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038952587 ⟸ XM_039096659
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000076540 ⟸ ENSRNOT00000110274

Ensembl Acc Id:

ENSRNOP00000081447 ⟸ ENSRNOT00000097450

RefSeq Acc Id:	XP_063133259 ⟸ XM_063277189
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000108976 ⟸ ENSRNOT00000132289

Ensembl Acc Id:

ENSRNOP00000105249 ⟸ ENSRNOT00000137769

Ensembl Acc Id:

ENSRNOP00000103687 ⟸ ENSRNOT00000163618

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0JPN5-F1-model_v2	AlphaFold	A0JPN5	1-270	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700856

Promoter ID:

EPDNEW_R11380

Type:

multiple initiation site

Name:

Ccdc68_1

Description:

coiled-coil domain containing 68

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	68,408,922 - 68,408,982	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561424	AgrOrtholog
BioCyc Gene	G2FUF-7087	BioCyc
Ensembl Genes	ENSRNOG00000021381	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000039702	ENTREZGENE
	ENSRNOT00000039702.6	UniProtKB/TrEMBL
	ENSRNOT00000097450.2	UniProtKB/TrEMBL
	ENSRNOT00000110274	ENTREZGENE
	ENSRNOT00000110274.2	UniProtKB/TrEMBL
	ENSRNOT00000132289.1	UniProtKB/TrEMBL
	ENSRNOT00000137769.1	UniProtKB/TrEMBL
	ENSRNOT00000163618	ENTREZGENE
	ENSRNOT00000163618.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.1490	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7104038	IMAGE-MGC_LOAD
InterPro	Tuftelin_GRINL1A/MYZAP/CCD68	UniProtKB/TrEMBL
KEGG Report	rno:291530	UniProtKB/TrEMBL
MGC_CLONE	MGC:156733	IMAGE-MGC_LOAD
NCBI Gene	291530	ENTREZGENE
PANTHER	GDOWN1	UniProtKB/TrEMBL
	PTHR23171:SF3	UniProtKB/TrEMBL
PhenoGen	Ccdc68	PhenoGen
RatGTEx	ENSRNOG00000021381	RatGTEx
UniProt	A0A8I5Y0E9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZSZ9	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LPJ2_RAT	UniProtKB/TrEMBL
	A0ABK0LS78_RAT	UniProtKB/TrEMBL
	A0ABK0LT00_RAT	UniProtKB/TrEMBL
	A0JPN5	ENTREZGENE, UniProtKB/TrEMBL
	A6IXZ1	ENTREZGENE, UniProtKB/TrEMBL
	A6IXZ2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-29	Ccdc68	coiled-coil domain containing 68	RGD1561424_predicted	similar to CTCL tumor antigen se57-1 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1561424_predicted	similar to CTCL tumor antigen se57-1 (predicted)	LOC291530	similar to CTCL tumor antigen se57-1	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC291530	similar to CTCL tumor antigen se57-1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar