Advanced Search (OLGA)

Gene: Ier5l (immediate early response 5-like) Rattus norvegicus

Analyze

Symbol:

Ier5l

Name:

immediate early response 5-like

RGD ID:

1561058

Description:

Orthologous to human IER5L (immediate early response 5 like); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

immediate early response gene 5-like protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IER5L (immediate early response 5 like)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ier5l (immediate early response 5-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ier5l (immediate early response 5 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IER5L (immediate early response 5 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IER5L (immediate early response 5 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ier5l (immediate early response 5 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IER5L (immediate early response 5 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IER5L (immediate early response 5 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ier5l (immediate early response 5 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ier5l (immediate early response 5 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SPATA31D1 (SPATA31 subfamily D member 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	IER5L (immediate early response 5 like)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ier5l (immediate early response 5-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ier5l (immediate early response 5-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ier5l (immediate early response 5-like)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ier5l	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ier5l	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	34,141,866 - 34,143,457 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	34,139,672 - 34,144,452 (-)	Ensembl				GRCr8
mRatBN7.2	3	13,744,056 - 13,745,647 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	13,744,078 - 13,745,647 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	16,815,581 - 16,817,172 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	25,400,543 - 25,402,134 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	23,646,713 - 23,648,296 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	9,036,351 - 9,037,942 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	9,036,373 - 9,037,942 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	14,389,470 - 14,391,061 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	9,515,947 - 9,517,538 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	8,510,665 - 8,512,260 (-)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

alpha-Zearalanol (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

atrazine (ISO)

azathioprine (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

choline (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

DDE (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dimethylarsinous acid (ISO)

dioxygen (ISO)

diquat (ISO)

dorsomorphin (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

L-methionine (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

microcystin-LR (ISO)

Monobutylphthalate (ISO)

Muraglitazar (EXP)

N-methyl-4-phenylpyridinium (EXP)

niclosamide (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

progesterone (ISO)

propanal (ISO)

quercetin (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

Tesaglitazar (EXP)

tetrachloromethane (ISO)

Theaflavin 3,3'-digallate (ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
2.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

Ier5l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	34,141,866 - 34,143,457 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	34,139,672 - 34,144,452 (-)	Ensembl				GRCr8
mRatBN7.2	3	13,744,056 - 13,745,647 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	13,744,078 - 13,745,647 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	16,815,581 - 16,817,172 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	25,400,543 - 25,402,134 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	23,646,713 - 23,648,296 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	9,036,351 - 9,037,942 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	9,036,373 - 9,037,942 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	14,389,470 - 14,391,061 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	9,515,947 - 9,517,538 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	8,510,665 - 8,512,260 (-)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

IER5L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	129,175,552 - 129,178,261 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	129,175,552 - 129,178,261 (-)	Ensembl			hg38	GRCh38
GRCh37	9	131,937,831 - 131,940,540 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	130,977,652 - 130,980,361 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	129,018,511 - 129,020,080	NCBI
Celera	9	102,590,120 - 102,592,833 (-)	NCBI		Celera
Cytogenetic Map	9	q34.11	NCBI
HuRef	9	101,545,290 - 101,547,633 (-)	NCBI		HuRef
CHM1_1	9	132,088,662 - 132,091,375 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	141,379,030 - 141,381,743 (-)	NCBI		T2T-CHM13v2.0

Ier5l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	30,362,643 - 30,364,211 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	30,361,549 - 30,364,231 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	30,472,631 - 30,474,199 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	30,471,537 - 30,474,219 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	30,328,151 - 30,329,719 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	30,293,547 - 30,296,228 (-)	NCBI		MGSCv36	mm8
Celera	2	30,177,428 - 30,179,159 (-)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	21.71	NCBI

Ier5l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955570	1,480,851 - 1,482,098 (-)	Ensembl
ChiLan1.0	NW_004955570	1,479,582 - 1,482,281 (-)	NCBI	ChiLan1.0	ChiLan1.0

IER5L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	10,170,905 - 10,175,897 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	10,175,514 - 10,177,132 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	100,300,931 - 100,303,651 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

IER5L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	54,509,842 - 54,512,554 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	54,510,047 - 54,511,276 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	53,705,489 - 53,708,162 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	55,405,734 - 55,408,446 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	55,405,943 - 55,407,169 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	54,192,384 - 54,195,091 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	54,504,499 - 54,507,213 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	54,597,894 - 54,600,607 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ier5l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	196,814,556 - 196,817,331 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	16,584,381 - 16,585,639 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936487	16,584,203 - 16,585,824 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IER5L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	269,454,099 - 269,455,310 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	269,453,920 - 269,455,524 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	303,469,008 - 303,471,644 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IER5L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	8,988,180 - 8,990,935 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	8,988,433 - 8,989,650 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666096	576,232 - 578,931 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ier5l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	5,953,868 - 5,955,073 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624760	5,953,687 - 5,956,362 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ier5l
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	5,158,869 - 5,161,519 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ier5l
7 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	80
Interacting mature miRNAs:	92
Transcripts:	ENSRNOT00000036770
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	29056275	47904329	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
10450811	Scl73	Serum cholesterol level QTL 73	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat
10450808	Scl72	Serum cholesterol level QTL 72	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
10450806	Scl71	Serum cholesterol level QTL 71	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	28625339	67641995	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	6125437	51125437	Rat
8693641	Alc30	Alcohol consumption QTL 30	2	0.739	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	3	30832384	44921701	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	36721849	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	6556347	51556347	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	15272348	60272348	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	29056275	47904329	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat

Markers in Region

AI070911

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,743,134 - 13,743,318 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,035,430 - 9,035,613	NCBI	Rnor6.0
Rnor_5.0	3	14,388,549 - 14,388,732	UniSTS	Rnor5.0
RGSC_v3.4	3	9,515,026 - 9,515,209	UniSTS	RGSC3.4
Celera	3	8,509,744 - 8,509,927	UniSTS
RH 3.4 Map	3	51.5	UniSTS
Cytogenetic Map	3	p12	UniSTS

ECD21896

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,744,154 - 13,744,391 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,036,450 - 9,036,686	NCBI	Rnor6.0
Rnor_5.0	3	14,389,569 - 14,389,805	UniSTS	Rnor5.0
RGSC_v3.4	3	9,516,046 - 9,516,282	UniSTS	RGSC3.4
Celera	3	8,510,764 - 8,511,000	UniSTS
Cytogenetic Map	3	p12	UniSTS

ECD22059

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,743,611 - 13,743,843 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,035,907 - 9,036,138	NCBI	Rnor6.0
Rnor_5.0	3	14,389,026 - 14,389,257	UniSTS	Rnor5.0
RGSC_v3.4	3	9,515,503 - 9,515,734	UniSTS	RGSC3.4
Celera	3	8,510,221 - 8,510,452	UniSTS
Cytogenetic Map	3	p12	UniSTS

REN36007

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,744,361 - 13,744,635 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,036,657 - 9,036,930	NCBI	Rnor6.0
Rnor_5.0	3	14,389,776 - 14,390,049	UniSTS	Rnor5.0
RGSC_v3.4	3	9,516,253 - 9,516,526	UniSTS	RGSC3.4
Celera	3	8,510,971 - 8,511,244	UniSTS
Cytogenetic Map	3	p12	UniSTS

REN36008

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,744,154 - 13,744,386 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,036,450 - 9,036,681	NCBI	Rnor6.0
Rnor_5.0	3	14,389,569 - 14,389,800	UniSTS	Rnor5.0
RGSC_v3.4	3	9,516,046 - 9,516,277	UniSTS	RGSC3.4
Celera	3	8,510,764 - 8,510,995	UniSTS
Cytogenetic Map	3	p12	UniSTS

REN36005

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,745,085 - 13,745,344 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,037,381 - 9,037,639	NCBI	Rnor6.0
Rnor_5.0	3	14,390,500 - 14,390,758	UniSTS	Rnor5.0
RGSC_v3.4	3	9,516,977 - 9,517,235	UniSTS	RGSC3.4
Celera	3	8,511,699 - 8,511,957	UniSTS
Cytogenetic Map	3	p12	UniSTS

REN36009

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,743,951 - 13,744,176 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,036,247 - 9,036,471	NCBI	Rnor6.0
Rnor_5.0	3	14,389,366 - 14,389,590	UniSTS	Rnor5.0
RGSC_v3.4	3	9,515,843 - 9,516,067	UniSTS	RGSC3.4
Celera	3	8,510,561 - 8,510,785	UniSTS
Cytogenetic Map	3	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	67	161	91	90	59	90	59	6	353	189	9	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC115341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000036770 ⟹ ENSRNOP00000060846

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	13,744,078 - 13,745,647 (-)	Ensembl
Rnor_6.0 Ensembl	3	9,036,373 - 9,037,942 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000146179 ⟹ ENSRNOP00000111418

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	34,139,672 - 34,144,452 (-)	Ensembl

RefSeq Acc Id:

NM_001025041 ⟹ NP_001020212

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	34,141,866 - 34,143,457 (-)	NCBI
mRatBN7.2	3	13,744,056 - 13,745,647 (-)	NCBI
Rnor_6.0	3	9,036,351 - 9,037,942 (-)	NCBI
Rnor_5.0	3	14,389,470 - 14,391,061 (-)	NCBI
RGSC_v3.4	3	9,515,947 - 9,517,538 (-)	RGD
Celera	3	8,510,665 - 8,512,260 (-)	RGD

Sequence:

show sequence

CGCCGTCTGGGGAGCGTGAGCCTGCGGGTGGCGCGCAACGCATGGTGGCGACTTCTCTCGGAGT
GTCGCCGACCCGCCGACCCGGGCTCGGTTCCCTGTGCCCGGCGCGCCCGGGCGACCAACTGGAG
ACACACGCAAGCAGCAGCATTCGCAGCACCAGAGGCGGTTGCTCCGCCGCCCGCGTCTCCGCGG
GAGCATGGAGTGCGCCCTGGACGCCCAGAGCCTGATCAGCATCTCCCTGCGCAAGATCCACAGC
TCCCGGACCCAGCGCGGCGGCATCAAGCTGCACAAGAACCTCCTGGTGTCCTACGTGCTCCGCA
ACGCGCGCCAGCTCTACCTGAGCGAGCGCTACGCCGAGCTCTACCGGCGCCAGCAGCAGCAGCA
GCAGCAGCAACAGCAGCCGCCCCACCACCAGCACCAGCACCTCGCTTACGCGGCGCCCGGAATG
CCGGCCAGCGCGGCCGACTTCGGCCCGCTCCAACTTGGTGGCGGCGGGGACGCGGAGGCGCGCG
AGCCGGTCGCCCGGCACCAGCTGCACCAGCTCCACCAGCTCCACCAGCTGCACCTCCAGCAGCA
GCTGCACCAACACCAGCACCCGGCGCCCAGGGGCTGCACGGCGGCGGCGCCGGTGGCGGTGGCC
GGGGCGCCCGCGGGCTGCGCGGGGGCGCTCTCGGAGCTGCCCGGGTGCGCTGCGCTCCAGCCGC
CGCACGGCGCGCCCCACCGCGGGCAGCACTTGGAGCCGCTGCAGCCCGGTCCTGCGCCGCTGCC
GCCGCCCGCGCCCGCCGCGCTCTGCCCGCGGGACCCTCGCGTCCCGGCCGCCTGCTCTGCGCCC
TCGGCGCCTCCGGGGGCTGCTCCTCCGACCGTCGCTGCCTCCTCTCCGCCTGCCTCTCCAGCCC
CTTCCTCATCCCCTGGCTTCTACCGGGGCGCGTACCCGGCCCCCTCGGACTTCGGCGTACACTG
CAGCAGCCAGACCACTGTGCTGGACCTGGACACTCACGTGGTGACCACGGTAGAAAACGGCTAC
TTGCACCAGGACTGCTGCGCCTCCGCCCACTGCCCCTGCTGTGGCCAGGGCGCTCCGGGACCGG
GTCTGGCGTCCGCCGCTGGTTGCAAGCGCAAGTATTACCCTGGCCAGGAGGAAGAGGACGACGA
GGAGGAGGATGCGGGCGACCTGGGAGCCGAGCCCCCCGGGGGCACGCCGTTCGCCCCCTGTAAG
CGCGCCCGCTTCGAGGACTTCTGCCCGGACTCGTCCCCGGACGCGTCCAACATCTCAAACTTGA
TCTCCATCTTTGGCTCGGGCTTCTCGGGGCTGGTGAGCCGACAGCCGGACTCCTCGGAGCAGCC
GCCGCCGCTCAACGGGCAGCTGTGCGCCAAGCAGGCGCTCGCCAGCCTCGGCGCCTGGACTCGA
GCCATTGTCGCCTTCTAGGGACCCCCCGAGGGCATGGGGACCCTGGGCCCCGCGGGGCTGGGGC
CAGACAAAGACTCGGCCAAGGGGTGATAGGGAGCGAGCGGGTCCCGGCCACTCGGGGTTGAGCT
GGGGGCGAGCAGAGGCTGATGTTTTATAAATTGTAAAATAAAAAAAAATCTAAAAAAAAAAAAA
AAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020212	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87095	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060846.1
	ENSRNOP00000111418
GenBank Protein	Q5PQP0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020212 ⟸ NM_001025041

- UniProtKB:

Q5PQP0 (UniProtKB/Swiss-Prot), A6JTZ1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQQQQQ
QQQQPPHHQHQHLAYAAPGMPASAADFGPLQLGGGGDAEAREPVARHQLHQLHQLHQLHLQQQL
HQHQHPAPRGCTAAAPVAVAGAPAGCAGALSELPGCAALQPPHGAPHRGQHLEPLQPGPAPLPP
PAPAALCPRDPRVPAACSAPSAPPGAAPPTVAASSPPASPAPSSSPGFYRGAYPAPSDFGVHCS
SQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPGLASAAGCKRKYYPGQEEEDDEE
EDAGDLGAEPPGGTPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQPP
PLNGQLCAKQALASLGAWTRAIVAF

hide sequence

Ensembl Acc Id:

ENSRNOP00000060846 ⟸ ENSRNOT00000036770

Ensembl Acc Id:

ENSRNOP00000111418 ⟸ ENSRNOT00000146179

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5PQP0-F1-model_v2	AlphaFold	Q5PQP0	1-409	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691961

Promoter ID:

EPDNEW_R2486

Type:

single initiation site

Name:

Ier5l_1

Description:

immediate early response 5-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	9,037,952 - 9,038,012	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561058	AgrOrtholog
BioCyc Gene	G2FUF-50210	BioCyc
Ensembl Genes	ENSRNOG00000024846	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000073054	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000036770.5	UniProtKB/Swiss-Prot
	ENSRNOT00000146179	ENTREZGENE
IMAGE_CLONE	IMAGE:7191438	IMAGE-MGC_LOAD
InterPro	IER	UniProtKB/Swiss-Prot
KEGG Report	rno:499772	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94639	IMAGE-MGC_LOAD
NCBI Gene	499772	ENTREZGENE
PANTHER	PTHR15895	UniProtKB/Swiss-Prot
Pfam	IER	UniProtKB/Swiss-Prot
PhenoGen	Ier5l	PhenoGen
RatGTEx	ENSRNOG00000024846	RatGTEx
	ENSRNOG00000073054	RatGTEx
UniProt	A6JTZ1	ENTREZGENE, UniProtKB/TrEMBL
	IER5L_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-02-09	Ier5l	immediate early response 5-like			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message