Advanced Search (OLGA)

Gene: Calhm3 (calcium homeostasis modulator 3) Rattus norvegicus

Analyze

Symbol:

Calhm3

Name:

calcium homeostasis modulator 3

RGD ID:

1560215

Description:

Predicted to enable monoatomic cation channel activity and voltage-gated monoatomic ion channel activity. Predicted to be involved in ATP export; protein heterooligomerization; and sensory perception of taste. Predicted to be located in basolateral plasma membrane. Predicted to be active in plasma membrane. Orthologous to human CALHM3 (calcium homeostasis modulator 3); INTERACTS WITH 6-propyl-2-thiouracil; bisphenol A; copper atom.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

calcium homeostasis modulator protein 3; Fam26a; family with sequence similarity 26, member A; LOC499368; RGD1560215; similar to OTTHUMP00000059163

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CALHM3 (calcium homeostasis modulator 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Calhm3 (calcium homeostasis modulator 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Calhm3 (calcium homeostasis modulator 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CALHM3 (calcium homeostasis modulator 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CALHM3 (calcium homeostasis modulator 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Calhm3 (calcium homeostasis modulator 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CALHM3 (calcium homeostasis modulator 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CALHM3 (calcium homeostasis modulator 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Calhm3 (calcium homeostasis modulator 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Calhm3 (calcium homeostasis modulator 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GJD3 (gap junction protein delta 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CALHM3 (calcium homeostasis modulator 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Calhm3 (calcium homeostasis modulator 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	calhm3 (calcium homeostasis modulator 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	clhm-1	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	calhm3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,984,593 - 255,989,594 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	255,983,410 - 256,007,697 (-)	Ensembl				GRCr8
mRatBN7.2	1	246,043,258 - 246,048,259 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	246,043,258 - 246,048,259 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	254,169,967 - 254,174,958 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,863,528 - 260,868,722 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,511,976 - 253,517,198 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	1	255,320,030 - 255,325,019 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	1	260,235,638 - 260,240,627 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	1	257,004,060 - 257,009,051 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	1	253,559,622 - 253,564,613 (-)	NCBI		F344_StmMcwi
Rnor_6.0	1	266,928,596 - 266,935,678 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,929,299 - 266,934,303 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	274,359,007 - 274,366,044 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	252,475,877 - 252,482,258 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	241,815,754 - 241,820,044 (-)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

6-propyl-2-thiouracil (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

clothianidin (ISO)

copper atom (EXP)

copper(0) (EXP)

okadaic acid (ISO)

pentanal (ISO)

phenobarbital (ISO)

propanal (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ATP export (IEA,ISO)

ATP transport (IEA,ISO)

monoatomic cation transmembrane transport (IEA)

monoatomic ion transmembrane transport (IEA)

monoatomic ion transport (IEA)

protein heterooligomerization (IEA,ISO)

sensory perception of taste (IEA,ISO)

Cellular Component

basolateral plasma membrane (IEA,ISO)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

monoatomic cation channel activity (IBA)

protein binding (ISO)

voltage-gated channel activity (IEA,ISO)

voltage-gated monoatomic ion channel activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:29681531

Genomics

Comparative Map Data

Calhm3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,984,593 - 255,989,594 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	255,983,410 - 256,007,697 (-)	Ensembl				GRCr8
mRatBN7.2	1	246,043,258 - 246,048,259 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	246,043,258 - 246,048,259 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	254,169,967 - 254,174,958 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,863,528 - 260,868,722 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,511,976 - 253,517,198 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	1	255,320,030 - 255,325,019 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	1	260,235,638 - 260,240,627 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	1	257,004,060 - 257,009,051 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	1	253,559,622 - 253,564,613 (-)	NCBI		F344_StmMcwi
Rnor_6.0	1	266,928,596 - 266,935,678 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,929,299 - 266,934,303 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	274,359,007 - 274,366,044 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	252,475,877 - 252,482,258 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	241,815,754 - 241,820,044 (-)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

CALHM3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	103,472,804 - 103,479,240 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	103,472,804 - 103,479,240 (-)	Ensembl			hg38	GRCh38
GRCh37	10	105,232,561 - 105,238,997 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	105,222,551 - 105,228,981 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	105,222,567 - 105,228,987	NCBI
Celera	10	98,972,496 - 98,978,932 (-)	NCBI		Celera
Cytogenetic Map	10	q24.33	NCBI
HuRef	10	98,863,342 - 98,869,779 (-)	NCBI		HuRef
CHM1_1	10	105,516,670 - 105,523,110 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	104,360,104 - 104,366,544 (-)	NCBI		T2T-CHM13v2.0

Calhm3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	47,140,138 - 47,146,203 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	47,140,048 - 47,146,203 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	47,151,699 - 47,157,764 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	47,151,609 - 47,157,764 (-)	Ensembl			mm10	GRCm38
MGSCv37	19	47,226,189 - 47,232,254 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	47,204,920 - 47,223,719 (-)	NCBI		MGSCv36	mm8
MGSCv36	19	47,077,270 - 47,096,186 (-)	NCBI		MGSCv36	mm8
Celera	19	51,992,373 - 51,998,445 (+)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	39.37	NCBI

Calhm3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955485	7,089,498 - 7,092,767 (+)	Ensembl
ChiLan1.0	NW_004955485	7,089,268 - 7,092,968 (+)	NCBI	ChiLan1.0	ChiLan1.0

CALHM3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	115,356,643 - 115,403,942 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	115,361,972 - 115,409,271 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	100,070,313 - 100,095,208 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	103,531,298 - 103,537,746 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	103,531,298 - 103,537,746 (-)	Ensembl			panPan2	panpan1.1

CALHM3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	15,833,952 - 15,843,640 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	15,833,838 - 15,839,995 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	16,005,870 - 16,015,559 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	16,310,152 - 16,319,840 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	16,310,085 - 16,318,655 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	15,859,169 - 15,868,826 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	15,886,983 - 15,896,671 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	16,025,598 - 16,035,287 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Calhm3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	30,986,861 - 31,004,452 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936600	2,600,804 - 2,607,732 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936600	2,603,852 - 2,607,624 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CALHM3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	114,406,589 - 114,413,170 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	114,406,491 - 114,413,348 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CALHM3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	96,520,508 - 96,543,924 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	96,520,912 - 96,527,841 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	57,636,753 - 57,660,223 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Calhm3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624831	2,700,597 - 2,703,885 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624831	2,700,597 - 2,703,885 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Calhm3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	46,685,149 - 46,690,868 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Calhm3
32 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	122
Count of miRNA genes:	104
Interacting mature miRNAs:	105
Transcripts:	ENSRNOT00000036202
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
1598839	Rf56	Renal function QTL 56			renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	255849111	270518180	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	ectoderm	endocrine system	endoderm	hemolymphoid system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
7	66	9	5	10	2	24	13	61	4	31	5	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC112451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000036202 ⟹ ENSRNOP00000033883

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	255,984,043 - 256,007,697 (-)	Ensembl
mRatBN7.2 Ensembl	1	246,043,258 - 246,048,259 (-)	Ensembl
Rnor_6.0 Ensembl	1	266,929,299 - 266,934,303 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000138473 ⟹ ENSRNOP00000106591

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	255,983,410 - 255,989,793 (-)	Ensembl

RefSeq Acc Id:

NM_001191956 ⟹ NP_001178885

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,984,593 - 255,989,594 (-)	NCBI
mRatBN7.2	1	246,043,258 - 246,048,259 (-)	NCBI
Dahl_SR_JrHsd	1	255,320,030 - 255,325,019 (-)	NCBI
Lyon_Normotensive	1	260,235,638 - 260,240,627 (-)	NCBI
Lyon_Hypertensive	1	257,004,060 - 257,009,051 (-)	NCBI
F344_StmMcwi	1	253,559,622 - 253,564,613 (-)	NCBI
Rnor_6.0	1	266,929,299 - 266,934,303 (-)	NCBI
Rnor_5.0	1	274,359,007 - 274,366,044 (-)	NCBI
Celera	1	241,815,754 - 241,820,044 (-)	NCBI

Sequence:

show sequence

ATGGACAGGTTCCGAATGCTCTTCCAGAACTTCCAGTCCAGCTCGGAGTCGGTGACGAACGGCA
TCTGCCTCCTGCTGGCTGCTGTCACCGTCAAGATGTACTCCTCCCTCGACTTCAACTGTCCCTG
CCTAGAGCACTACAATGCCCTCTATGGCCTGGGCCTGCTGCTCACACCCCCTCTGGCCCTCTTC
CTCTGTGGTCTCTTGGTCAATAGACAGTCTGTGTTGATGGTGGAGGAGTGGCGCCGGCCAGCAG
GGCACCGGAGGAAGGACCTAGGCATCATCAGGTACATGTGCTCCTCTGTGCTGCAGCGAGCTCT
AGCAGCACCTCTGGTCTGGATCTTACTGGCCCTCCTTGATGGGAAGTGTCTTGTGTGTGCCTTC
AGCAACTCCGTTGACCCTGAGAAGTTTCTGGATTTTGCTAATATGACCCCCAGCCAGGTGCAGC
TCTTCCTAGCCAAGGTGCCCTGCAAGGAAGATGAGCTGGTTAAAACCAGCCCAGCTCGCAAGGC
TGTGTCTCGGTACCTCCGGTGCCTGTCACAGGCCATCGGCTGGAGTATAACCTTGCTGGTGATA
GTGGTGGCCTTCCTAGCCCGCTGTCTGAGGCCCTGCTTCAACCAGACGGTCTTCCTACAGCGCA
GATACTGGAGCAACTATATGGACCTGGAACAGAAGCTCTTTGATGAGACATGCTGTGAGCATGC
GCGGGACTTCGCACATCGCTGCGTGCTGCACTTCTTCGCAAGCATGCAGAGCGAGCTACGCGCT
CTGGGGTTACATCGGGACCCAGCTGGCGAGATCCTAGAGTCACAGGAACCCCCGGAGCCCCCGG
AGGAGCCGGGTAGTGAAAGCGGGAAGGCCCACCTGCGTGCAATCTCCAGCCGAGAGCAAGTGAA
TCACCTCCTAAGTACCTGGTACTCCAGCAAGCCACCGCTTGACCTCGCAGCCTCCCCAAGGCTC
TGGGAGCCTGGCCTCAATCATCGTGCCCCTATAGCTGCTCCAGGCACCAAGCTGGGCCACCAGC
TTGATGTATAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001178885	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94374	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000033883
	ENSRNOP00000033883.3
	ENSRNOP00000106591.1

RefSeq Acc Id:

NP_001178885 ⟸ NM_001191956

- UniProtKB:

D4A158 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDRFRMLFQNFQSSSESVTNGICLLLAAVTVKMYSSLDFNCPCLEHYNALYGLGLLLTPPLALF
LCGLLVNRQSVLMVEEWRRPAGHRRKDLGIIRYMCSSVLQRALAAPLVWILLALLDGKCLVCAF
SNSVDPEKFLDFANMTPSQVQLFLAKVPCKEDELVKTSPARKAVSRYLRCLSQAIGWSITLLVI
VVAFLARCLRPCFNQTVFLQRRYWSNYMDLEQKLFDETCCEHARDFAHRCVLHFFASMQSELRA
LGLHRDPAGEILESQEPPEPPEEPGSESGKAHLRAISSREQVNHLLSTWYSSKPPLDLAASPRL
WEPGLNHRAPIAAPGTKLGHQLDV

hide sequence

Ensembl Acc Id:

ENSRNOP00000033883 ⟸ ENSRNOT00000036202

Ensembl Acc Id:

ENSRNOP00000106591 ⟸ ENSRNOT00000138473

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A158-F1-model_v2	AlphaFold	D4A158	1-344	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560215	AgrOrtholog
BioCyc Gene	G2FUF-55487	BioCyc
Ensembl Genes	ENSRNOG00000026086	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000036202	ENTREZGENE
	ENSRNOT00000036202.6	UniProtKB/TrEMBL
	ENSRNOT00000138473.1	UniProtKB/TrEMBL
InterPro	FAM26	UniProtKB/TrEMBL
KEGG Report	rno:499368	UniProtKB/TrEMBL
NCBI Gene	499368	ENTREZGENE
PANTHER	PTHR32261	UniProtKB/TrEMBL
	PTHR32261:SF7	UniProtKB/TrEMBL
Pfam	Ca_hom_mod	UniProtKB/TrEMBL
PhenoGen	Calhm3	PhenoGen
RatGTEx	ENSRNOG00000026086	RatGTEx
UniProt	A0ABK0LRK5_RAT	UniProtKB/TrEMBL
	D4A158	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-10	Calhm3	calcium homeostasis modulator 3	Fam26a	family with sequence similarity 26, member A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Fam26a	family with sequence similarity 26, member A	RGD1560215_predicted	similar to OTTHUMP00000059163 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1560215_predicted	similar to OTTHUMP00000059163 (predicted)	LOC499368	similar to OTTHUMP00000059163	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499368	similar to OTTHUMP00000059163			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message