Advanced Search (OLGA)

Gene: Cnih4 (cornichon family member 4) Rattus norvegicus

Analyze

Symbol:

Cnih4

Name:

cornichon family member 4

RGD ID:

1559740

Description:

Predicted to enable CCR5 chemokine receptor binding activity. Predicted to be involved in endoplasmic reticulum to Golgi vesicle-mediated transport. Predicted to be located in endoplasmic reticulum-Golgi intermediate compartment. Predicted to be active in COPII-coated ER to Golgi transport vesicle and endoplasmic reticulum membrane. Orthologous to human CNIH4 (cornichon family member 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cornichon family AMPA receptor auxiliary protein 4; cornichon homolog 4; cornichon homolog 4 (Drosophila); LOC289324; RGD1559740; similar to Protein HSPC163

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CNIH4 (cornichon family member 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cnih4 (cornichon family AMPA receptor auxiliary protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cnih4 (cornichon family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CNIH4 (cornichon family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CNIH4 (cornichon family AMPA receptor auxiliary protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cnih4 (cornichon family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CNIH4 (cornichon family AMPA receptor auxiliary protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CNIH4 (cornichon family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cnih4 (cornichon family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cnih4 (cornichon family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Cnih4 (cornichon family AMPA receptor auxiliary protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cnih4 (cornichon family AMPA receptor auxiliary protein 4)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CNIH4 (cornichon family member 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CNIH4 (cornichon family member 4)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cnih4 (cornichon family AMPA receptor auxiliary protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cnih4 (cornichon family AMPA receptor auxiliary protein 4)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ERV14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ERV14	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ERV15	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ERV15	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	cnir	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	cnir	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cnih4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	95,442,054 - 95,458,163 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	95,442,054 - 95,459,590 (+)	Ensembl				GRCr8
mRatBN7.2	13	92,910,315 - 92,926,428 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	92,910,315 - 92,927,853 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	95,415,636 - 95,431,748 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	96,815,538 - 96,831,650 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	93,991,175 - 94,007,276 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	99,469,382 - 99,490,693 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	99,473,044 - 99,489,263 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	104,468,780 - 104,484,267 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	96,921,481 - 96,940,409 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	92,451,600 - 92,467,776 (+)	NCBI		Celera
Cytogenetic Map	13	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-phenylbutyric acid (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

formaldehyde (ISO)

gentamycin (EXP)

ivermectin (ISO)

methidathion (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

monosodium L-glutamate (ISO)

nimesulide (EXP)

paracetamol (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

Salinomycin (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

tolcapone (EXP)

triadimefon (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endoplasmic reticulum to Golgi vesicle-mediated transport (IBA,IEA,ISO)

vesicle-mediated transport (IEA)

Cellular Component

COPII-coated ER to Golgi transport vesicle (IBA)

endoplasmic reticulum (IEA,ISO)

endoplasmic reticulum membrane (IBA)

endoplasmic reticulum-Golgi intermediate compartment (IEA,ISO)

membrane (IEA)

Molecular Function

CCR5 chemokine receptor binding (IEA,ISO)

protein binding (ISO)

signaling receptor binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:24405750

Genomics

Comparative Map Data

Cnih4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	95,442,054 - 95,458,163 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	95,442,054 - 95,459,590 (+)	Ensembl				GRCr8
mRatBN7.2	13	92,910,315 - 92,926,428 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	92,910,315 - 92,927,853 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	95,415,636 - 95,431,748 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	96,815,538 - 96,831,650 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	93,991,175 - 94,007,276 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	99,469,382 - 99,490,693 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	99,473,044 - 99,489,263 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	104,468,780 - 104,484,267 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	96,921,481 - 96,940,409 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	92,451,600 - 92,467,776 (+)	NCBI		Celera
Cytogenetic Map	13	q26	NCBI

CNIH4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	224,356,803 - 224,379,452 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	224,356,858 - 224,379,459 (+)	Ensembl			hg38	GRCh38
GRCh37	1	224,544,581 - 224,567,154 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	222,611,218 - 222,630,318 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	197,735,537 - 197,754,630 (+)	NCBI		Celera
Cytogenetic Map	1	q42.11	NCBI
HuRef	1	195,064,711 - 195,087,194 (+)	NCBI		HuRef
CHM1_1	1	225,817,049 - 225,839,535 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	223,545,746 - 223,568,267 (+)	NCBI		T2T-CHM13v2.0

Cnih4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	180,977,437 - 180,996,559 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	180,972,258 - 180,996,559 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	181,150,366 - 181,168,994 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	181,144,693 - 181,168,994 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	183,081,062 - 183,099,125 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	182,987,662 - 183,003,101 (+)	NCBI		MGSCv36	mm8
Celera	1	188,217,931 - 188,235,901 (+)	NCBI		Celera
Cytogenetic Map	1	H4	NCBI
cM Map	1	84.53	NCBI

Cnih4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955520	991,417 - 1,007,107 (-)	Ensembl
ChiLan1.0	NW_004955520	991,477 - 1,006,731 (-)	NCBI	ChiLan1.0	ChiLan1.0

CNIH4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	25,150,396 - 25,170,703 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	25,101,321 - 25,121,637 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	199,825,889 - 199,848,664 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	204,834,031 - 204,853,888 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	204,834,031 - 204,855,747 (+)	Ensembl			panPan2	panpan1.1

CNIH4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	40,010,412 - 40,022,425 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	40,010,425 - 40,022,347 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	39,492,398 - 39,508,004 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	39,844,709 - 39,860,649 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	39,844,576 - 39,860,616 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	39,685,664 - 39,701,588 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	39,693,120 - 39,708,864 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	39,961,956 - 39,977,882 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cnih4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	53,329,004 - 53,344,647 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936526	1,402,593 - 1,419,315 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936526	1,402,593 - 1,418,710 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CNIH4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	12,688,817 - 12,713,203 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	12,688,833 - 12,705,426 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	15,124,470 - 15,128,426 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CNIH4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	5,402,570 - 5,424,008 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	5,402,151 - 5,423,757 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	5,580,601 - 5,600,358 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cnih4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624835	5,977,977 - 5,993,317 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624835	5,977,921 - 5,995,209 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cnih4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	59,509,698 - 59,527,531 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cnih4
78 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	683
Count of miRNA genes:	293
Interacting mature miRNAs:	370
Transcripts:	ENSRNOT00000004939
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004939 ⟹ ENSRNOP00000004939

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	95,442,126 - 95,459,590 (+)	Ensembl
mRatBN7.2 Ensembl	13	92,910,357 - 92,927,853 (+)	Ensembl
Rnor_6.0 Ensembl	13	99,473,044 - 99,489,263 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107775 ⟹ ENSRNOP00000087381

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	92,910,335 - 92,925,451 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114514 ⟹ ENSRNOP00000082866

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	92,910,315 - 92,927,744 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000128673 ⟹ ENSRNOP00000101192

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	95,442,054 - 95,457,016 (+)	Ensembl

RefSeq Acc Id:

NM_001105981 ⟹ NP_001099451

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	95,442,054 - 95,458,163 (+)	NCBI
mRatBN7.2	13	92,910,315 - 92,926,428 (+)	NCBI
Rnor_6.0	13	99,473,044 - 99,489,263 (+)	NCBI
Rnor_5.0	13	104,468,780 - 104,484,267 (+)	NCBI
RGSC_v3.4	13	96,921,481 - 96,940,409 (+)	RGD
Celera	13	92,451,600 - 92,467,776 (+)	RGD

Sequence:

show sequence

ATGCATTTCCATGCTTTTCTGGGCCACAACTCCCGGCATGCCGCCTGTCCGGGCGGCGCGGCCC
GGAGCTGGTTTGACGGGCGGAGCGGCGGCAGAGGATGGAGGCGGTGGTGTTCCTCTTCTCGCTC
CTCGACTGTTGTTCGCTCATCTTCCTCTCTGTCTACTTCATCATTACACTGTCTGATTTAGAAT
GTGATTACATTAACGCTAGATCATGTTGCTCAAAATTAAACAAGTGGGTGATACCAGAGTTGGT
TGGCCACACCTTTGTCACTGTGCTGATGCTTGTTTCCTTGCACTGGGTCATCTTCCTTCTCAAC
TTACCTGTTGCCACATGGAATATATATAGGTTCATTATGGTGCCAAGTGGTAACATGGGAGTAT
TTGATCCAACAGAAATACACAACCGGGGACAGTTAAAGTCACACATGAAAGAAGCCATGATCAA
GCTTGGTTTCTACCTACTCTGTTTCTTCATGTATCTCTACAGTATGATTCTAGCGTTGATAAAT
GACTGAAGCTGGAGTAGCCGGGTTGAAGCCAGCCTACACTACACACTGCACAATCGAGGAACCA
GAGACTAAAACCACCCTTAGGACCGTGACCAGAGCAGTATATATTTTGGTCTTTGAACAAAAGA
ACTATTTTTGCTGTATTTTTACGACATAAAGTATTTAAAAAAAATAAATTGAGTTTTTGTAGAT
TTCTGATTTCTCAACCCCAACACATGAAGGTGTTTTGTCTCCTCTGTGGCTGTTTGGTAGAAGT
AGGAATATATGCCAGCTTTGCATGCCAAAGAGATAAAAGGCATACCTAAGAGTCCTTAACCCAG
TGGTTCTCAACCTGGGGGTCGCACCACCCCTTTAGGGGTCAAATGACTCACAGGGGTCACCTAA
GACCACTGAAAACATATTTACATTGTGATTCCTAACCGTAGCAAAATTAGTTATGAAGTAACAA
CAGAAATGATTTTATGGCTGGGGGGTTACAACATGAGGAACTGTGGCACAGCATTAGAAGGTTA
GAACCACCACCTTAGTAGATGGCCGACTGTCTGAAAAGCCAGAGCAGAAAGCAATACAGCTAAT
ATGGACAAATGAAGAAAGTCACGTTAATGTCGCCCAAGGATCTGAAGACATTTCAGCTGTCTTT
CAATAGAAAATGACGTTTTAAAATATATTTATTTGCAGTATTTGAAACCTTATGAGCCATGTGC
CCAAGTACAATGTAAGTCCTGCTTACAGAAAGGGAAAGTAAATTTAAAATCAAGATTCTATTAA
GGGCTTTCATTTTAAAGCTTGTACCTCCATAATCACCCCCACCTCTGTCTAATCACCTCAGCTC
TTGCCAGACCTTATTTTTGCACTGTAACTGTTCCATTTATATTTGATTTCTTTAATAATATATT
TTAATGGATTTGGAGAAGTGATTTGATAGAGTCACCCCACGTCAGAATGAGGAAACCGGTCAGT
CATTGTTAAACAATGAAACAAGAACAGCCTGCGAGTTGTTCACTTGTGCCGAATTCACTGCAGC
TCCTTTTCTCTGGCACTGACCACGTTGTGGACTGGGAACCCAGCGGAGCCACTGTGTGCACATG
GCAGTACCTAGCTCCTCTGGGAGAAAGCCCTTGCTCTGGGTCAGAGCAGGCGGTTAGCCTAGTC
T

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099451	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94850	(Get FASTA)	NCBI Sequence Viewer
	EDL94851	(Get FASTA)	NCBI Sequence Viewer
	EDL94852	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004939
	ENSRNOP00000004939.5
	ENSRNOP00000101192.1

RefSeq Acc Id:	NP_001099451 ⟸ NM_001105981
- UniProtKB:	D3ZTY0 (UniProtKB/TrEMBL), A6JGJ5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEAVVFLFSLLDCCSLIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELVGHTFVTVLMLV SLHWVIFLLNLPVATWNIYRFIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFYLLCFFMY LYSMILALIND hide sequence

Ensembl Acc Id:

ENSRNOP00000004939 ⟸ ENSRNOT00000004939

Ensembl Acc Id:

ENSRNOP00000087381 ⟸ ENSRNOT00000107775

Ensembl Acc Id:

ENSRNOP00000082866 ⟸ ENSRNOT00000114514

Ensembl Acc Id:

ENSRNOP00000101192 ⟸ ENSRNOT00000128673

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZTY0-F1-model_v2	AlphaFold	D3ZTY0	1-139	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699068

Promoter ID:

EPDNEW_R9593

Type:

initiation region

Name:

Cnih4_1

Description:

cornichon family AMPA receptor auxiliary protein 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	99,473,114 - 99,473,174	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1559740	AgrOrtholog
BioCyc Gene	G2FUF-17096	BioCyc
Ensembl Genes	ENSRNOG00000003717	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004939	ENTREZGENE
	ENSRNOT00000004939.7	UniProtKB/TrEMBL
	ENSRNOT00000128673.1	UniProtKB/TrEMBL
InterPro	Cornichon	UniProtKB/TrEMBL
KEGG Report	rno:289324	UniProtKB/TrEMBL
NCBI Gene	289324	ENTREZGENE
PANTHER	CORNICHON-RELATED	UniProtKB/TrEMBL
Pfam	Cornichon	UniProtKB/TrEMBL
PhenoGen	Cnih4	PhenoGen
RatGTEx	ENSRNOG00000003717	RatGTEx
SMART	Cornichon	UniProtKB/TrEMBL
UniProt	A0ABK0L830_RAT	UniProtKB/TrEMBL
	A6JGJ5	ENTREZGENE, UniProtKB/TrEMBL
	D3ZTY0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-03-08	Cnih4	cornichon family member 4	Cnih4	cornichon family AMPA receptor auxiliary protein 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-09-16	Cnih4	cornichon family AMPA receptor auxiliary protein 4	Cnih4	cornichon homolog 4 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-28	Cnih4	cornichon homolog 4 (Drosophila)	RGD1559740_predicted	similar to Protein HSPC163 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1559740_predicted	similar to Protein HSPC163 (predicted)	LOC289324	similar to Protein HSPC163	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC289324	similar to Protein HSPC163			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message