Advanced Search (OLGA)

Gene: Yod1 (YOD1 deubiquitinase) Rattus norvegicus

Analyze

Symbol:

Yod1

Name:

YOD1 deubiquitinase

RGD ID:

1359726

Description:

Predicted to enable K48-linked deubiquitinase activity; cysteine-type deubiquitinase activity; and ubiquitin protein ligase binding activity. Predicted to be involved in several processes, including ERAD pathway; negative regulation of retrograde protein transport, ER to cytosol; and protein deubiquitination. Predicted to be located in cytoplasm. Orthologous to human YOD1 (YOD1 deubiquitinase); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

HIV-induced protein-7-like protease; hshin7; MGC124915; ubiquitin thioesterase OTU1; YOD1 OTU deubiquinating enzyme 1 homolog; YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae); YOD1 OTU deubiquitinating enzyme 1 homologue; YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	YOD1 (YOD1 deubiquitinase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Yod1 (YOD1 deubiquitinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	YOD1 (YOD1 deubiquitinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	YOD1 (YOD1 deubiquitinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	YOD1 (YOD1 deubiquitinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Yod1 (YOD1 deubiquitinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Yod1 (YOD1 deubiquitinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LHFPL7 (LHFPL tetraspan subfamily member 7)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Yod1 (YOD1 deubiquitinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	YOD1 (YOD1 deubiquitinase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	YOD1 (YOD1 deubiquitinase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	yod1 (YOD1 deubiquitinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OTU1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OTU1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4603	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4603	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	yod1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	44,727,319 - 44,733,933 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	13	42,175,047 - 42,181,661 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	42,174,820 - 42,177,205 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	44,781,884 - 44,783,601 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	46,070,028 - 46,071,745 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	43,314,718 - 43,316,435 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	47,441,296 - 47,443,013 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	47,440,803 - 47,443,188 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	52,529,960 - 52,531,677 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	43,653,274 - 43,654,991 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	42,526,067 - 42,527,784 (+)	NCBI		Celera
RGSC_v3.1	13	43,667,316 - 43,669,034 (+)	NCBI
Cytogenetic Map	13	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

aflatoxin M1 (ISO)

aristolochic acid A (ISO)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP,ISO)

chlorpyrifos (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

curcumin (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

glyphosate (EXP)

gold atom (ISO)

gold(0) (ISO)

GSK-J4 (ISO)

imidacloprid (EXP)

indometacin (ISO)

iron dichloride (ISO)

lead(0) (ISO)

melphalan (ISO)

methylisothiazolinone (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

tetrachloromethane (EXP,ISO)

thiabendazole (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endoplasmic reticulum unfolded protein response (IBA,ISO,ISS)

ERAD pathway (IBA,ISO,ISS)

macroautophagy (ISO,ISS)

negative regulation of retrograde protein transport, ER to cytosol (ISO)

protein K11-linked deubiquitination (ISO,ISS)

protein K27-linked deubiquitination (ISO,ISS)

protein K29-linked deubiquitination (ISO,ISS)

protein K33-linked deubiquitination (ISO,ISS)

protein K48-linked deubiquitination (ISO,ISS)

protein K63-linked deubiquitination (ISO,ISS)

proteolysis (IEA)

response to unfolded protein (IEA)

Cellular Component

cytoplasm (IEA,ISO,ISS)

cytosol (ISO)

nucleoplasm (ISO)

nucleus (IBA)

plasma membrane (ISO)

Molecular Function

cysteine-type deubiquitinase activity (IBA,IEA,ISO,ISS)

cysteine-type peptidase activity (IEA)

hydrolase activity (IEA)

K48-linked deubiquitinase activity (ISO)

metal ion binding (IEA)

peptidase activity (IEA)

protein binding (ISO)

ubiquitin protein ligase binding (ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

Endoplasmic Reticulum-associated degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	A genomic analysis of rat proteases and protease inhibitors.	Puente XS and Lopez-Otin C, Genome Res 2004 Apr;14(4):609-22.
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:19818707	PMID:21376232	PMID:22871113	PMID:23827681	PMID:24068323	PMID:27753622	PMID:38042492

Genomics

Comparative Map Data

Yod1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	44,727,319 - 44,733,933 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	13	42,175,047 - 42,181,661 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	42,174,820 - 42,177,205 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	44,781,884 - 44,783,601 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	46,070,028 - 46,071,745 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	43,314,718 - 43,316,435 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	47,441,296 - 47,443,013 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	47,440,803 - 47,443,188 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	52,529,960 - 52,531,677 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	43,653,274 - 43,654,991 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	42,526,067 - 42,527,784 (+)	NCBI		Celera
RGSC_v3.1	13	43,667,316 - 43,669,034 (+)	NCBI
Cytogenetic Map	13	q13	NCBI

YOD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	207,043,849 - 207,053,116 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	207,043,849 - 207,052,980 (-)	Ensembl			hg38	GRCh38
GRCh37	1	207,217,194 - 207,226,461 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	205,283,817 - 205,291,045 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	180,468,698 - 180,475,926 (-)	NCBI		Celera
Cytogenetic Map	1	q32.1	NCBI
HuRef	1	177,914,550 - 177,923,681 (-)	NCBI		HuRef
CHM1_1	1	208,489,805 - 208,498,936 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	206,309,040 - 206,318,351 (-)	NCBI		T2T-CHM13v2.0

Yod1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	130,645,064 - 130,652,093 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	130,645,064 - 130,652,095 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	130,717,327 - 130,722,073 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	130,717,327 - 130,724,358 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	132,613,904 - 132,618,650 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	132,544,873 - 132,549,566 (+)	NCBI		MGSCv36	mm8
Celera	1	133,340,721 - 133,345,469 (+)	NCBI		Celera
Cytogenetic Map	1	E4	NCBI
cM Map	1	56.89	NCBI

YOD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	6,185,650 - 6,194,005 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	6,190,752 - 6,193,284 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	5,749,059 - 5,757,297 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	5,874,444 - 5,882,763 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	5,874,444 - 5,882,058 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	5,808,168 - 5,816,424 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	5,909,780 - 5,918,003 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	5,949,935 - 5,958,184 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

YOD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	67,672,651 - 67,681,826 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	67,672,640 - 67,681,889 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	74,057,174 - 74,061,141 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

YOD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	22,307,703 - 22,311,919 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	22,307,778 - 22,309,716 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	22,949,362 - 22,954,186 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Yod1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624807	4,443,650 - 4,446,373 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624807	4,443,653 - 4,448,759 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Yod1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	5,092,592 - 5,099,430 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Yod1
47 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	139
Count of miRNA genes:	107
Interacting mature miRNAs:	123
Transcripts:	ENSRNOT00000030476
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
9589141	Insul28	Insulin level QTL 28	10.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	13	11866254	56866254	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	24853925	69853925	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
1300163	Cardf1	Cardiac cell morphology QTL 1	4.18		aorta morphology trait (VT:0000272)	artery lesion measurement (CMO:0000975)	13	12448421	47969993	Rat
2317040	Aia21	Adjuvant induced arthritis QTL 21	2.75		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	17468282	62468282	Rat
2317046	Aia8	Adjuvant induced arthritis QTL 8	3.9700000286102295		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
2303032	Bp328	Blood pressure QTL 328			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	43736327	47969993	Rat
61339	Bp24	Blood pressure QTL 24		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	6002008	47359539	Rat
1331784	Bp222	Blood pressure QTL 222	2.944		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	24335432	55601132	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
2302275	Gluco37	Glucose level QTL 37	3.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	13	12448421	48744906	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	33794096	60914504	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	3088755	48088755	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	17711336	62711336	Rat
7411662	Foco29	Food consumption QTL 29	20.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	13	11866254	56866254	Rat

Markers in Region

RH144599

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	42,173,824 - 42,173,999 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	47,439,808 - 47,439,982	NCBI	Rnor6.0
Rnor_5.0	13	52,528,472 - 52,528,646	UniSTS	Rnor5.0
RGSC_v3.4	13	43,651,786 - 43,651,960	UniSTS	RGSC3.4
Celera	13	42,524,579 - 42,524,753	UniSTS
RH 3.4 Map	13	111.2	UniSTS
Cytogenetic Map	13	q13	UniSTS
Cytogenetic Map	13	q24-q25	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008889	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC107904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BN000319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000030476 ⟹ ENSRNOP00000031836

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	42,174,820 - 42,177,205 (+)	Ensembl
Rnor_6.0 Ensembl	13	47,440,803 - 47,443,188 (+)	Ensembl

RefSeq Acc Id:

NM_001008889 ⟹ NP_001008889

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	44,727,319 - 44,733,933 (+)	NCBI
mRatBN7.2	13	42,175,047 - 42,181,661 (+)	NCBI
Rnor_6.0	13	47,441,296 - 47,443,013 (+)	NCBI
Rnor_5.0	13	52,529,960 - 52,531,677 (+)	NCBI
RGSC_v3.4	13	43,653,274 - 43,654,991 (+)	RGD
Celera	13	42,526,067 - 42,527,784 (+)	RGD

Sequence:

show sequence

ATGTGGCGGCTCCGCTGCAAGGCCAAGGGTGGCACCCACGTTTTGCAGGGTCTTTCCAACCGGA
CCCGCTTACGGGAACTGCAGGGCCAAATCGCCGCTATCACCGGCATCGCTCCTGGCAGTCAGCG
AATCCTCGTCGGCTACCCACCAGAGTGCCTGGATCTCAGCGACCGGGACATCACTCTCGGGGAC
CTGCCCATCCAGTCAGGTGACATGCTGATTGTTGAAGAAGACCAAACCAGACCAAAAGCTTCAC
CTGCGTTTTCAAAACATGGTGCTCCTAGTTATGTCAGGGAAACTCTGCCTGTGCTTACCAGAAC
CGCAGTCCCAGCAGACAACTCTTGCCTCTTTACCAGTGTGTACTATGTAGTTGAAGGAGGAGTC
TTGAATCCAGCTTGTGCCCCTGAGATGAGACGCCTCATAGCACAAATTGTAGCCAGTGATCCAG
ACTTGTATAGTGAGGCAATACTGGGAAAGACAAACGAAGAGTACTGTGATTGGATCAGAAGGGA
TGATACTTGGGGGGGAGCAATTGAGATATCAATCCTGTCCAAGTTTTATCAATGTGAAATATGT
GTAGTAGATACACAGACAGTCAGAATTGATCGTTTTGGGGAAGATGCAGGCTATACCAAAAGGG
TTCTACTCATCTACGATGGCATTCACTACGATCCGCTTCAGCGAAACTTCCCTGATCCGGATAC
CCCTCCTCTGACCATTTTCTCCTCAAATGATGATATTGTTCTCGTACAAGCACTGGAATTAGCT
GATGAAGCTAGAAGAAAGAGACAGTTCACTGATGTAAACCGCTTCACCCTGAGATGCATGCTGT
GTCAGAAGGGCCTAACCGGACAAGCTGAAGCAAGGGACCATGCCAGGGAGACAGGCCATACCAA
CTTTGGAGAGGTGTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001008889	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI07905	(Get FASTA)	NCBI Sequence Viewer
	CAE48374	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000031836.2
GenBank Protein	Q32Q05	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008889 ⟸ NM_001008889

- UniProtKB:

Q32Q05 (UniProtKB/Swiss-Prot), Q6IE74 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MWRLRCKAKGGTHVLQGLSNRTRLRELQGQIAAITGIAPGSQRILVGYPPECLDLSDRDITLGD
LPIQSGDMLIVEEDQTRPKASPAFSKHGAPSYVRETLPVLTRTAVPADNSCLFTSVYYVVEGGV
LNPACAPEMRRLIAQIVASDPDLYSEAILGKTNEEYCDWIRRDDTWGGAIEISILSKFYQCEIC
VVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELA
DEARRKRQFTDVNRFTLRCMLCQKGLTGQAEARDHARETGHTNFGEV

hide sequence

Ensembl Acc Id:

ENSRNOP00000031836 ⟸ ENSRNOT00000030476

Protein Domains

OTU

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q32Q05-F1-model_v2	AlphaFold	Q32Q05	1-343	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698787

Promoter ID:

EPDNEW_R9312

Type:

single initiation site

Name:

Yod1_1

Description:

YOD1 deubiquitinase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	47,440,780 - 47,440,840	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359726	AgrOrtholog
BioCyc Gene	G2FUF-18368	BioCyc
Ensembl Genes	ENSRNOG00000025704	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000030476.3	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.70.80	UniProtKB/Swiss-Prot
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7454897	IMAGE-MGC_LOAD
InterPro	OTU1_Ubl	UniProtKB/Swiss-Prot
	OTU_dom	UniProtKB/Swiss-Prot
	Papain-like_cys_pep_sf	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
	Znf_C2H2_type	UniProtKB/Swiss-Prot
KEGG Report	rno:363982	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124915	IMAGE-MGC_LOAD
NCBI Gene	363982	ENTREZGENE
PANTHER	PTHR13312	UniProtKB/Swiss-Prot
	UBIQUITIN THIOESTERASE OTU1	UniProtKB/Swiss-Prot
Pfam	OTU	UniProtKB/Swiss-Prot
	OTU1_UBXL	UniProtKB/Swiss-Prot
	zf-C2H2_OTU1_C	UniProtKB/Swiss-Prot
PhenoGen	Yod1	PhenoGen
PROSITE	OTU	UniProtKB/Swiss-Prot
	ZINC_FINGER_C2H2_1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000025704	RatGTEx
Superfamily-SCOP	SSF54001	UniProtKB/Swiss-Prot
	SSF54236	UniProtKB/Swiss-Prot
UniProt	OTU1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6IE74	ENTREZGENE
UniProt Secondary	Q6IE74	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-06-14	Yod1	YOD1 deubiquitinase	Yod1	YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-23	Yod1	YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)	Yod1	YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Yod1	YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae)	hshin7	HIV-induced protein-7-like protease	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-29	hshin7	HIV-induced protein-7-like protease			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)