Advanced Search (OLGA)

Gene: Sgcg (sarcoglycan, gamma) Rattus norvegicus

Analyze

Symbol:

Sgcg

Name:

sarcoglycan, gamma

RGD ID:

1359577

Description:

Predicted to be involved in cardiac muscle tissue development and heart contraction. Predicted to act upstream of or within gene expression. Predicted to be located in plasma membrane. Predicted to be part of sarcoglycan complex. Predicted to be active in sarcolemma. Human ortholog(s) of this gene implicated in autosomal recessive limb-girdle muscular dystrophy type 2C and type 2 diabetes mellitus. Orthologous to human SGCG (sarcoglycan gamma); PARTICIPATES IN arrhythmogenic right ventricular cardiomyopathy pathway; dilated cardiomyopathy pathway; hypertrophic cardiomyopathy pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

gamma sarcoglycan; gamma-sarcoglycan; MGC94674; sarcoglycan, gamma (dystrophin-associated glycoprotein)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SGCG (sarcoglycan gamma)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sgcg (sarcoglycan, gamma (dystrophin-associated glycoprotein))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sgcg (sarcoglycan gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SGCG (sarcoglycan gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SGCG (sarcoglycan gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sgcg (sarcoglycan gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SGCG (sarcoglycan gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SGCG (sarcoglycan gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sgcg (sarcoglycan gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sgcg (sarcoglycan gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SGCD (sarcoglycan delta)	HGNC	OrthoDB
Homo sapiens (human):	SGCZ (sarcoglycan zeta)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	SGCG (sarcoglycan gamma)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sgcg (sarcoglycan, gamma (dystrophin-associated glycoprotein))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sgcg (sarcoglycan, gamma)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sgn-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Scgdelta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Scgdelta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sgcg	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sgcg	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	39,564,920 - 39,611,149 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	39,564,923 - 39,611,149 (-)	Ensembl				GRCr8
mRatBN7.2	15	35,388,836 - 35,435,072 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	35,386,534 - 35,435,148 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	37,247,345 - 37,293,820 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	38,397,984 - 38,444,459 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	36,849,534 - 36,895,767 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	41,549,330 - 41,595,275 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	41,549,331 - 41,595,345 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	45,357,059 - 45,401,752 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	40,363,607 - 40,410,061 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	35,086,619 - 35,133,591 (-)	NCBI		Celera
RGSC_v3.1	15	40,379,307 - 40,425,761 (-)	NCBI
Cytogenetic Map	15	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive limb-girdle muscular dystrophy (ISO)

autosomal recessive limb-girdle muscular dystrophy type 2C (ISO,ISS)

autosomal recessive limb-girdle muscular dystrophy type 2D (ISO)

dilated cardiomyopathy (ISO)

genetic disease (ISO)

limb-girdle muscular dystrophy (ISS)

osteoarthritis (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (EXP)

coumestrol (ISO)

Cuprizon (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

Enterolactone (ISO)

fonofos (ISO)

furan (EXP)

gentamycin (EXP)

glycidol (EXP)

hydroquinone (ISO)

isoprenaline (EXP)

methimazole (EXP)

methoxychlor (EXP)

mono(2-ethylhexyl) phthalate (ISO)

Muraglitazar (EXP)

nickel atom (ISO)

ozone (ISO)

paracetamol (EXP)

parathion (ISO)

perfluorooctanoic acid (EXP)

pioglitazone (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

terbufos (ISO)

titanium dioxide (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

troglitazone (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cardiac muscle tissue development (IBA)

gene expression (ISO)

heart contraction (IBA)

Cellular Component

cytoskeleton (IEA)

dystroglycan complex (IEA,ISO)

membrane (IEA)

plasma membrane (IEA,ISO)

sarcoglycan complex (IBA,IEA,ISO)

sarcolemma (IBA,IEA,ISO)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

arrhythmogenic right ventricular cardiomyopathy pathway (IEA)

dilated cardiomyopathy pathway (IEA)

hypertrophic cardiomyopathy pathway (IEA)

myocarditis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	A slowly progressive form of limb-girdle muscular dystrophy type 2C associated with founder mutation in the SGCG gene in Puerto Rican Hispanics.	Al-Zaidy SA, etal., Mol Genet Genomic Med. 2015 Mar;3(2):92-8. doi: 10.1002/mgg3.125. Epub 2015 Jan 8.
2.	Three single nucleotide polymorphisms associated with type 2 diabetes mellitus in a Chinese population.	Chen M, etal., Exp Ther Med. 2017 Jan;13(1):121-126. doi: 10.3892/etm.2016.3920. Epub 2016 Nov 18.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Gamma-sarcoglycan deficiency leads to muscle membrane defects and apoptosis independent of dystrophin.	Hack AA, etal., J Cell Biol 1998 Sep 7;142(5):1279-87.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	Novel mutations in three patients with LGMD2C with phenotypic differences.	Vermeer S, etal., Pediatr Neurol. 2004 Apr;30(4):291-4.

Additional References at PubMed

PMID:10481911	PMID:10678176	PMID:12189167	PMID:16524571	PMID:17164264	PMID:22894000

Genomics

Comparative Map Data

Sgcg
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	39,564,920 - 39,611,149 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	39,564,923 - 39,611,149 (-)	Ensembl				GRCr8
mRatBN7.2	15	35,388,836 - 35,435,072 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	35,386,534 - 35,435,148 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	37,247,345 - 37,293,820 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	38,397,984 - 38,444,459 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	36,849,534 - 36,895,767 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	41,549,330 - 41,595,275 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	41,549,331 - 41,595,345 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	45,357,059 - 45,401,752 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	40,363,607 - 40,410,061 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	35,086,619 - 35,133,591 (-)	NCBI		Celera
RGSC_v3.1	15	40,379,307 - 40,425,761 (-)	NCBI
Cytogenetic Map	15	p12	NCBI

SGCG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	23,160,508 - 23,325,162 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	23,180,877 - 23,325,165 (+)	Ensembl			hg38	GRCh38
GRCh37	13	23,734,647 - 23,899,301 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	22,653,091 - 22,797,304 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	13	22,653,090 - 22,797,304	NCBI
Celera	13	4,818,082 - 4,962,307 (+)	NCBI		Celera
Cytogenetic Map	13	q12.12	NCBI
HuRef	13	4,568,485 - 4,711,933 (+)	NCBI		HuRef
CHM1_1	13	23,723,673 - 23,867,900 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	22,367,302 - 22,531,974 (+)	NCBI		T2T-CHM13v2.0

Sgcg
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	61,456,555 - 61,495,939 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	61,456,564 - 61,495,939 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	61,219,106 - 61,275,062 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	61,219,115 - 61,258,490 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	61,837,952 - 61,877,327 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	60,175,169 - 60,212,543 (-)	NCBI		MGSCv36	mm8
MGSCv36	14	52,317,272 - 52,354,896 (-)	NCBI		MGSCv36	mm8
Celera	14	58,986,681 - 59,013,511 (-)	NCBI		Celera
Cytogenetic Map	14	D1	NCBI
cM Map	14	32.27	NCBI

Sgcg
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955497	3,615,003 - 3,701,300 (+)	Ensembl
ChiLan1.0	NW_004955497	3,592,041 - 3,702,780 (+)	NCBI	ChiLan1.0	ChiLan1.0

SGCG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	22,775,506 - 22,942,534 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	13,882,542 - 14,049,284 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	4,471,680 - 4,638,419 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	22,767,914 - 22,932,350 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	22,810,771 - 22,932,350 (+)	Ensembl			panPan2	panpan1.1

SGCG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	15,300,303 - 15,429,555 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	15,249,622 - 15,430,044 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	15,385,366 - 15,463,994 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	15,438,637 - 15,566,980 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	15,437,354 - 15,568,272 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	15,313,964 - 15,391,928 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	15,315,358 - 15,394,278 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	15,371,563 - 15,450,196 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0
Dog Cytomap	25	q21-q23	NCBI

Sgcg
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	117,471,929 - 117,579,002 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936688	2,083,846 - 2,191,876 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936688	2,083,930 - 2,191,206 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SGCG
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	11	2,310,280 - 2,380,054 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	1,615,434 - 1,649,827 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SGCG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	3,117,708 - 3,216,776 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	3,135,446 - 3,215,553 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666057	41,319,540 - 41,402,448 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sgcg
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624776	14,397,269 - 14,548,168 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624776	14,396,560 - 14,547,188 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sgcg
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	63,163,660 - 63,193,197 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sgcg
253 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	57
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000019639
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	31855803	92671517	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	28527732	73527732	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	22728353	42072050	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	22336351	52597086	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	19155762	87086765	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	22336351	67336351	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat

Markers in Region

RH137232

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	35,388,940 - 35,389,137 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	41,549,435 - 41,549,631	NCBI	Rnor6.0
Rnor_5.0	15	45,357,164 - 45,357,360	UniSTS	Rnor5.0
RGSC_v3.4	15	40,363,712 - 40,363,908	UniSTS	RGSC3.4
Celera	15	35,086,724 - 35,086,920	UniSTS
RH 3.4 Map	15	229.5	UniSTS
Cytogenetic Map	15	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
13	12	62	96	56	55	24	28	24	6	217	123	11	68	49	92	31	2	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001006993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019639 ⟹ ENSRNOP00000019639

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	39,564,923 - 39,611,149 (-)	Ensembl
mRatBN7.2 Ensembl	15	35,386,534 - 35,435,148 (-)	Ensembl
Rnor_6.0 Ensembl	15	41,549,331 - 41,595,345 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000152290 ⟹ ENSRNOP00000107603

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	39,564,923 - 39,585,217 (-)	Ensembl

RefSeq Acc Id:

NM_001006993 ⟹ NP_001006994

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	39,564,920 - 39,611,149 (-)	NCBI
mRatBN7.2	15	35,388,836 - 35,435,072 (-)	NCBI
Rnor_6.0	15	41,549,330 - 41,595,275 (-)	NCBI
Rnor_5.0	15	45,357,059 - 45,401,752 (-)	NCBI
RGSC_v3.4	15	40,363,607 - 40,410,061 (-)	RGD
Celera	15	35,086,619 - 35,133,591 (-)	RGD

Sequence:

show sequence

CAAAATGGGAGTTTAAATCTCTCCACCTCCACAGAGCTCAGGCCCTCATCGGGATCATTTCATC
AGTGTGGTTTCTGAGTGGCTGAGAGGATGGTGCGAGAACAGTACACCACGGTCACAGAGGGGAC
TCACATAGAGCGGCCTGAGAACCAGCATGTCTACAAGATCGGCATTTATGGATGGAGGAAGCGC
TGTCTGTACCTATTTGTTCTTATCCTCCTCACCATCCTCGTCGTGAATCTCGCTCTCACCATCT
GGATTCTGAGAGTGATGTGGTTTTCTCCAATAGGAATGGGTCACCTGCATGTTACGGCAGATGG
ACTTCGGCTGGAAGGGGAGTCAGAGTTTTTATTTCCGCTGTACGCCAAAGAAATACGCTCCAGA
GTGGACTCATCTCTGCTTCTGCAGTCAACTCAGAACGTGACAGTCAATGCTCGCAACTCAGAAG
GGGAGGTCACAGGCAGGGTGAAAGTGGGTGCCCAGATGGTAGAAGTCCAGAGCCAGCACTTACA
GATCAGTTCTGAAGATGGCAAGCCGCTGTTCACCGCCGAGGAGCAGGGCGTCGTGGTCGGCACC
GGCAGACTGCGGGTTACAGGGCCAGAAGGAGCTCTTTTTGAACACTCAGTGGAGACACCCCTTG
TCAGAGCTGAGCACCCATTTCAAGACCTTAGGTTGGAATCCCCAACTCGGAGTCTCAGCATGGA
TGCCCCAAGGGGCGTTCACATTGAAGCTCGTGCTGGAAAAATGGAGGCCCTTTCTCAGATGGAC
ATCGTCTTGCAGAGTAGTGATGGAGTGCTGGTGCTCGATGCTGAAACTGTGGGTTTGGCCAAGT
TGAAGCAGGGGACACAGGGTCCCCCTGGCAGCTCAAATGGAGTCTATGAGATCTGTGCATGTCC
TGATGGGAAGCTGTACCTGTCTATGGCTGGCGAGGCCACCACTTGCGAGGAACACAGCCACATC
TGTCTCTGACCACTCCCTCTTCTGCAGAGCACCTACGGTGTCCCGGAGAGACCACAGCTGTGTC
CCACAGCTGGATTGGAGCTGGACTCACTGCCAAAACACTTAGAAGCGCGCAGGGGAGCGTGCCC
ACGGGACTGTTGGGCCGAAGTCTACCTGGTTTTAGAACGATCCAAAGAAATGGCAGGAATGCAT
TCACTGTATTCCTCTTTCTAGCCCTGCTCCAGATCTCTCACAATGAACTGCTACCCGCAAACAA
TTTATAGTACTCAATGGCAGACATCTGTCTCCTCCCAAACGAACGGTTGGCTGGAGGACTCTAA
CATGCCCCAACTGTGCACACCTCCTCCTTTAGATTAAACCTCAAGGGCTCCCTTCAGCTGAGTG
CAATGTGTCTGATTCACCAAGAGATCTCCAGGGTTTGCAGGGAGTTTAAGGTCAATGTGATTTT
CAATATGGAGCTAAGGAGAGAAATGACACAAATTTAGTCATGCCTTCTATATACACACACCTAT
GAGCAATAAAAATGACACTTTTCCAGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001006994	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83748	(Get FASTA)	NCBI Sequence Viewer
	EDL85272	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019639
	ENSRNOP00000019639.4
	ENSRNOP00000107603.1

RefSeq Acc Id:

NP_001006994 ⟸ NM_001006993

- UniProtKB:

Q5XID6 (UniProtKB/TrEMBL), A6K6B2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVREQYTTVTEGTHIERPENQHVYKIGIYGWRKRCLYLFVLILLTILVVNLALTIWILRVMWFS
PIGMGHLHVTADGLRLEGESEFLFPLYAKEIRSRVDSSLLLQSTQNVTVNARNSEGEVTGRVKV
GAQMVEVQSQHLQISSEDGKPLFTAEEQGVVVGTGRLRVTGPEGALFEHSVETPLVRAEHPFQD
LRLESPTRSLSMDAPRGVHIEARAGKMEALSQMDIVLQSSDGVLVLDAETVGLAKLKQGTQGPP
GSSNGVYEICACPDGKLYLSMAGEATTCEEHSHICL

hide sequence

Ensembl Acc Id:

ENSRNOP00000019639 ⟸ ENSRNOT00000019639

Ensembl Acc Id:

ENSRNOP00000107603 ⟸ ENSRNOT00000152290

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XID6-F1-model_v2	AlphaFold	Q5XID6	1-292	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699741

Promoter ID:

EPDNEW_R10264

Type:

initiation region

Name:

Sgcg_1

Description:

sarcoglycan, gamma

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	41,595,295 - 41,595,355	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359577	AgrOrtholog
BioCyc Gene	G2FUF-13512	BioCyc
Ensembl Genes	ENSRNOG00000014603	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019639	ENTREZGENE
	ENSRNOT00000019639.7	UniProtKB/TrEMBL
	ENSRNOT00000152290.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7192349	IMAGE-MGC_LOAD
InterPro	Sarcoglycan	UniProtKB/TrEMBL
	Sarcoglycan_gamma/delta/zeta	UniProtKB/TrEMBL
KEGG Report	rno:305941	UniProtKB/TrEMBL
MGC_CLONE	MGC:94674	IMAGE-MGC_LOAD
NCBI Gene	305941	ENTREZGENE
PANTHER	PTHR12939	UniProtKB/TrEMBL
	PTHR12939:SF4	UniProtKB/TrEMBL
Pfam	Sarcoglycan_1	UniProtKB/TrEMBL
PhenoGen	Sgcg	PhenoGen
RatGTEx	ENSRNOG00000014603	RatGTEx
UniProt	A0ABK0LUI3_RAT	UniProtKB/TrEMBL
	A6K6B2	ENTREZGENE, UniProtKB/TrEMBL
	Q5XID6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-03-16	Sgcg	sarcoglycan, gamma	Sgcg	sarcoglycan, gamma (dystrophin-associated glycoprotein)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Sgcg	sarcoglycan, gamma (dystrophin-associated glycoprotein)		gamma sarcoglycan	Name updated	1299863	APPROVED
2005-07-29	Sgcg	gamma sarcoglycan			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)