Advanced Search (OLGA)

Gene: Nans (N-acetylneuraminate synthase) Rattus norvegicus

Analyze

Symbol:

Nans

Name:

N-acetylneuraminate synthase

RGD ID:

1311943

Description:

Predicted to enable N-acylneuraminate-9-phosphate synthase activity. Predicted to be involved in CMP-N-acetylneuraminate biosynthetic process and N-acetylneuraminate biosynthetic process. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in spondyloepimetaphyseal dysplasia, Genevieve-type. Orthologous to human NANS (N-acetylneuraminate synthase); PARTICIPATES IN amino sugar metabolic pathway; french type sialuria pathway; sialic acid storage disease pathway; INTERACTS WITH 17beta-estradiol; alpha-Zearalanol; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC298071; N-acetylneuraminic acid synthase; N-acetylneuraminic acid synthase (sialic acid synthase); sialic acid synthase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NANS (N-acetylneuraminate synthase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nans (N-acetylneuraminic acid synthase (sialic acid synthase))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nans (N-acetylneuraminate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NANS (N-acetylneuraminate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NANS (N-acetylneuraminate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nans (N-acetylneuraminate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NANS (N-acetylneuraminate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NANS (N-acetylneuraminate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nans (N-acetylneuraminate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nans (N-acetylneuraminate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NANS (N-acetylneuraminate synthase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nans (N-acetylneuraminic acid synthase (sialic acid synthase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nansa (N-acetylneuraminic acid synthase a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nansa (N-acetylneuraminic acid synthase a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	nansb (N-acetylneuraminic acid synthase b)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	NANS	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nans	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	65,575,970 - 65,593,164 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	65,576,015 - 65,610,547 (+)	Ensembl				GRCr8
mRatBN7.2	5	60,780,441 - 60,797,583 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	60,780,392 - 60,814,950 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	62,751,649 - 62,768,600 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	64,571,024 - 64,587,971 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	64,540,435 - 64,557,380 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	5	65,709,123 - 65,726,145 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	5	67,281,343 - 67,298,365 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	5	66,599,704 - 66,616,728 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	5	60,468,113 - 60,485,060 (+)	NCBI		F344_StmMcwi
Rnor_6.0	5	62,109,352 - 62,126,492 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	62,109,328 - 62,126,494 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	66,637,340 - 66,654,051 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	63,072,673 - 63,090,183 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	59,342,273 - 59,359,222 (+)	NCBI		Celera
RGSC_v3.1	5	63,069,334 - 63,090,249 (+)	NCBI
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

bone development disease (ISO)

Desbuquois dysplasia (ISO)

Developmental Disabilities (ISO)

nephronophthisis (ISO)

spondyloepimetaphyseal dysplasia, Genevieve-type (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

aceneuramic acid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

Azoxymethane (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

buspirone (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diuron (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

enzyme inhibitor (ISO)

ethanol (EXP)

fipronil (EXP)

folic acid (ISO)

glafenine (EXP)

ivermectin (ISO)

L-methionine (ISO)

lead(0) (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-acetylneuraminic acid (ISO)

okadaic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

perfluorooctanoic acid (EXP,ISO)

pirinixic acid (ISO)

poly(I:C) (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tanespimycin (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate biosynthetic process (IEA)

carbohydrate derivative biosynthetic process (IEA)

CMP-N-acetylneuraminate biosynthetic process (IEA,ISO)

N-acetylneuraminate biosynthetic process (IEA,ISO)

N-acetylneuraminate metabolic process (IEA,ISO)

Cellular Component

cytosol (IDA,IEA,ISO)

nucleoplasm (IEA,ISO)

Molecular Function

N-acylneuraminate-9-phosphate synthase activity (IBA,IEA,ISO)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

amino sugar metabolic pathway (IEA,ISO)

french type sialuria pathway (ISO)

nucleotide sugar metabolic pathway (IEA)

sialic acid storage disease pathway (ISO)

Tay-Sachs disease pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Subcellular localization and tissue distribution of sialic acid-forming enzymes. N-acetylneuraminate-9-phosphate synthase and N-acetylneuraminate 9-phosphatase.	Van Rinsum J, etal., Biochem J. 1984 Oct 15;223(2):323-8. doi: 10.1042/bj2230323.

Additional References at PubMed

PMID:8889548	PMID:10873658	PMID:12060780	PMID:12477932	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Nans
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	65,575,970 - 65,593,164 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	65,576,015 - 65,610,547 (+)	Ensembl				GRCr8
mRatBN7.2	5	60,780,441 - 60,797,583 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	60,780,392 - 60,814,950 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	62,751,649 - 62,768,600 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	64,571,024 - 64,587,971 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	64,540,435 - 64,557,380 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	5	65,709,123 - 65,726,145 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	5	67,281,343 - 67,298,365 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	5	66,599,704 - 66,616,728 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	5	60,468,113 - 60,485,060 (+)	NCBI		F344_StmMcwi
Rnor_6.0	5	62,109,352 - 62,126,492 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	62,109,328 - 62,126,494 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	66,637,340 - 66,654,051 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	63,072,673 - 63,090,183 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	59,342,273 - 59,359,222 (+)	NCBI		Celera
RGSC_v3.1	5	63,069,334 - 63,090,249 (+)	NCBI
Cytogenetic Map	5	q22	NCBI

NANS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	98,056,732 - 98,083,077 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	98,056,674 - 98,083,087 (+)	Ensembl			hg38	GRCh38
GRCh37	9	100,819,014 - 100,845,359 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	99,858,842 - 99,885,178 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	97,898,575 - 97,924,912	NCBI
Celera	9	71,333,236 - 71,359,642 (+)	NCBI		Celera
Cytogenetic Map	9	q22.33	NCBI
HuRef	9	70,419,093 - 70,445,498 (+)	NCBI		HuRef
CHM1_1	9	100,965,405 - 100,991,809 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	110,217,512 - 110,255,020 (+)	NCBI		T2T-CHM13v2.0

Nans
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	46,489,319 - 46,503,439 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	46,489,248 - 46,503,632 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	46,489,329 - 46,503,438 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	46,489,248 - 46,503,632 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	46,502,201 - 46,516,310 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	46,510,429 - 46,524,538 (+)	NCBI		MGSCv36	mm8
Celera	4	46,514,378 - 46,528,658 (+)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	24.83	NCBI

Nans
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	27,424,674 - 27,448,952 (-)	Ensembl
ChiLan1.0	NW_004955419	27,424,648 - 27,449,058 (-)	NCBI	ChiLan1.0	ChiLan1.0

NANS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	41,375,294 - 41,409,330 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	41,377,671 - 41,411,713 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	69,146,016 - 69,172,355 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	97,267,088 - 97,293,385 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	97,267,088 - 97,293,385 (+)	Ensembl			panPan2	panpan1.1

NANS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	55,286,290 - 55,310,904 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	55,243,854 - 55,350,194 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	53,719,899 - 53,744,431 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	56,398,348 - 56,422,901 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	56,398,269 - 56,425,087 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	54,894,201 - 54,918,744 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	54,924,876 - 54,949,416 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	55,621,300 - 55,645,840 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nans
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	170,225,274 - 170,244,274 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	6,772,796 - 6,791,902 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	6,772,831 - 6,791,854 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NANS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	239,881,876 - 239,919,251 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	239,881,984 - 239,912,727 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	268,051,524 - 268,082,265 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NANS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	41,339,636 - 41,363,920 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	41,334,900 - 41,363,855 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	38,378,935 - 38,412,718 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nans
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624825	2,771,057 - 2,795,815 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624825	2,771,301 - 2,795,813 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nans
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	99,573,735 - 99,590,404 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nans
142 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	339
Count of miRNA genes:	196
Interacting mature miRNAs:	220
Transcripts:	ENSRNOT00000012260
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	38011670	83011670	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	52665372	94894052	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	32751649	77751649	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
6907115	Mcs29	Mammary carcinoma susceptibility QTL 29			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	38004331	83004331	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	23671493	79046465	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	65089051	103648916	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	38011670	83011670	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	38011670	83011670	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	39019942	102105896	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	33311673	78311673	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	32751649	77751649	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	39985948	84985948	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33311673	78311673	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	39526924	84526924	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	48523123	91770353	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	60511627	105511627	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	64589016	109589016	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	7065535	74335773	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	26023211	71023211	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	64589016	93503770	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	56546393	101546393	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	23671493	68671493	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	64589016	91762830	Rat

Markers in Region

RH132906

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	60,796,466 - 60,796,646 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	62,125,376 - 62,125,555	NCBI	Rnor6.0
Rnor_5.0	5	66,652,935 - 66,653,114	UniSTS	Rnor5.0
RGSC_v3.4	5	63,089,067 - 63,089,246	UniSTS	RGSC3.4
Celera	5	59,358,106 - 59,358,285	UniSTS
RH 3.4 Map	5	389.5	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG669394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB327791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB704610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV116524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DV726438	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012260 ⟹ ENSRNOP00000012260

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	65,576,015 - 65,593,163 (+)	Ensembl
mRatBN7.2 Ensembl	5	60,780,412 - 60,797,575 (+)	Ensembl
Rnor_6.0 Ensembl	5	62,109,328 - 62,126,494 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108229 ⟹ ENSRNOP00000094739

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	65,576,015 - 65,610,547 (+)	Ensembl
mRatBN7.2 Ensembl	5	60,780,392 - 60,814,950 (+)	Ensembl

RefSeq Acc Id:

NM_001106655 ⟹ NP_001100125

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	65,576,024 - 65,593,164 (+)	NCBI
mRatBN7.2	5	60,780,441 - 60,797,583 (+)	NCBI
Dahl_SR_JrHsd	5	65,709,123 - 65,726,145 (+)	NCBI
Lyon_Normotensive	5	67,281,343 - 67,298,365 (+)	NCBI
Lyon_Hypertensive	5	66,599,704 - 66,616,728 (+)	NCBI
F344_StmMcwi	5	60,468,113 - 60,485,060 (+)	NCBI
Rnor_6.0	5	62,109,352 - 62,126,492 (+)	NCBI
Rnor_5.0	5	66,637,340 - 66,654,051 (+)	NCBI
RGSC_v3.4	5	63,072,673 - 63,090,183 (+)	RGD
Celera	5	59,342,273 - 59,359,222 (+)	RGD

Sequence:

show sequence

GGGGCAGCGAACAGGCGCGGTTAAGCACCATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGCTG
GGTGGGTGGACAGCACCCGTGCTTCATCATCGCGGAGATCGGCCAGAACCACCAAGGAGACTTA
GATGTGGCCAAGCGCATGATCCGCACTGCCAAGGAGTGTGGGGCCGACTGCGCTAAGTTTCAGA
AGAGTGAGTTGGAGTTCAAGTTTAACCGGAAGGCCCTGGAGAGACCATATACTTCGAAGCATTC
ATGGGGGAAGACTTACGGGGAGCACAAACGACATCTAGAATTCAGCCACGATCAGTACAAGGAG
CTGCAGAGCTACGCGCAGGAGATTGGCATCTTCTTCACTGCGTCTGGCATGGATGAGATGGCAG
TTGAGTTTCTGCATGAACTGAATGTTCCCTTTTTCAAAGTTGGATCTGGAGACACTAACAATTT
TCCCTACCTGGAAAAGACAGCCAAGAAAGGTCGTCCTATGGTGATCTCCAGTGGGATGCAGTCC
ATGGACACCATGAAGCAAGTCTATCAGATCGTGAAGCCCCTGAATCCCAACTTCTGCTTCCTCC
AGTGCACCAGTGCGTACCCACTACAGCCTGAGGATGCCAACCTGCGCGTCATCTCGGAATACCA
GAAGCTCTTTCCTGACATTCCCATAGGGTATTCTGGGCACGAGACAGGCATCGCCATATCTGTA
GCTGCAGTGGCCCTGGGGGCCAAGGTGTTGGAACGTCATATAACTTTGGACAAGACCTGGAAGG
GGAGTGACCACTTAGCCTCACTGGAGCCTGGAGAACTGGCAGAGCTGGTGCGGTCTGTGCGTCT
GGTGGAGCGGGCACTGGGCTCCCCAGCCAAGCAGCTCCTGCCCTGTGAGATGGCCTGCAACGAG
AAGCTCGGCAAGTCCGTGGTAGCCAAAGTGAAAATCCCAGCAGGCACCATCCTGACCCTGGACA
TGCTCACTGTGAAGGTGGGGGAACCCAAAGGCTATCCTCCTGAAGACATCTTCAACCTGGTGGG
CAAAAAGGTGCTGGTCACTATTGAAGAAGATGACACGGTCATGGAGGAATCCGTGGAAAGTCAA
AGCAAGAAAATCAAGGCTTAAAATAAAGTGCCACTCCGGGCTTCTCGGCCACCCTGCTACTGCT
GTCCAGTGTGTTGGGTGCAGAGGGCCAGGAGTGTTGGTCTCCAGGCCACCCTGTCACAGTGACC
ACCTGTGTCCAGCTCACTGGACAGGAGGAGCCAATGAGGCTCTTCTGCTTTGAAGTGCCCAGCC
AGCGAAGGCAGCCCAGAGCACACGCAGCTCCTCTAGGGTTTCTGTGTAGCTCTGTCAACATCTT
GAGCCTTCATGTTCCCACTCAATAAAGCAGCTCCAGGGACCTGAGCTCTCAGTTCCTCATAGAG
CACTGAACAGTGGGCATTAGACTCTGCCTGAGGCCCTAAGGGCAGAGACAAGCTCTCCTGTCTT
TATGAGCATAGGCAGGGACAGAGCACTTGGTCCTCCCTTTGGCAAATTGTCACCATCAGAGGCC
TAGGGCCATGGTTCTTTGCAGCCAGTCCCTTTCTCAGAGGCCTTCTCAGACAGCAGGTGCACAC
TAACCCACAGTACAGTTGACCAACAGGCAGGGATGAACACGGGTCTGTAAGGAGGTGGCCATGG
AGTCTGCACATTTTAGCCATAGGGGGCGGTGCAGAAATCAACCCCACCATAAGCACCAGTGTCT
TGTCACACTTGACAGATTACAAACCCAGACAAAGGTCCTGTTGTTTGACATCTTTAAGTGCAGT
TAAGTGCATGAACACTCATAGAGGTTCACTGTCACAATTCATTCTGTTCTTGGGAATCGATGCT
GAGATTAATCATTGTTCTTTTTCAAGTATCTCCTTGTCTTTACTTTAAAAAACTTTTTTTGAGA
CAGGATCTCACTCTATCCCTGGCTGGCCTAGAACTGGACTTAGACCCTGAGATCTGCTTGCCTC
TGCCACCTGAGGGCTGAGATTAAAGCTGTGTACCACCAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063287329 ⟹ XP_063143399

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	65,575,970 - 65,593,164 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100125	(Get FASTA)	NCBI Sequence Viewer
	XP_063143399	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61979	(Get FASTA)	NCBI Sequence Viewer
	EDL98842	(Get FASTA)	NCBI Sequence Viewer
	EDL98843	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012260
	ENSRNOP00000012260.4
	ENSRNOP00000094739.1

RefSeq Acc Id:

NP_001100125 ⟸ NM_001106655

- UniProtKB:

B1WC26 (UniProtKB/TrEMBL), F7ET93 (UniProtKB/TrEMBL), A0A8I6GKW3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRTAKECGADCAKFQKSELEFKFNR
KALERPYTSKHSWGKTYGEHKRHLEFSHDQYKELQSYAQEIGIFFTASGMDEMAVEFLHELNVP
FFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQP
EDANLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHLASLEP
GELAELVRSVRLVERALGSPAKQLLPCEMACNEKLGKSVVAKVKIPAGTILTLDMLTVKVGEPK
GYPPEDIFNLVGKKVLVTIEEDDTVMEESVESQSKKIKA

hide sequence

Ensembl Acc Id:

ENSRNOP00000012260 ⟸ ENSRNOT00000012260

Ensembl Acc Id:

ENSRNOP00000094739 ⟸ ENSRNOT00000108229

RefSeq Acc Id:	XP_063143399 ⟸ XM_063287329
- Peptide Label:	isoform X1

Protein Domains

AFP-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WC26-F1-model_v2	AlphaFold	B1WC26	1-359	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693714

Promoter ID:

EPDNEW_R4238

Type:

initiation region

Name:

Nans_1

Description:

N-acetylneuraminate synthase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	62,109,342 - 62,109,402	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311943	AgrOrtholog
BioCyc Gene	G2FUF-41404	BioCyc
Ensembl Genes	ENSRNOG00000008945	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012260	ENTREZGENE
	ENSRNOT00000012260.8	UniProtKB/TrEMBL
	ENSRNOT00000108229.2	UniProtKB/TrEMBL
Gene3D-CATH	3.20.20.70	UniProtKB/TrEMBL
	Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9029956	IMAGE-MGC_LOAD
InterPro	AFP_Neu5c_C	UniProtKB/TrEMBL
	AFP_Neu5c_C_sf	UniProtKB/TrEMBL
	Aldolase_TIM	UniProtKB/TrEMBL
	Neu5Ac_N	UniProtKB/TrEMBL
	Nonulosonic_Acid_Synth	UniProtKB/TrEMBL
	SAF	UniProtKB/TrEMBL
KEGG Report	rno:298071	UniProtKB/TrEMBL
MGC_CLONE	MGC:187791	IMAGE-MGC_LOAD
NCBI Gene	298071	ENTREZGENE
PANTHER	N-ACETYLNEURAMINATE SYNTHASE	UniProtKB/TrEMBL
	SIALIC ACID SYNTHASE	UniProtKB/TrEMBL
Pfam	NeuB	UniProtKB/TrEMBL
	SAF	UniProtKB/TrEMBL
PhenoGen	Nans	PhenoGen
PROSITE	AFP_LIKE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008945	RatGTEx
SMART	SAF	UniProtKB/TrEMBL
Superfamily-SCOP	AFP_Neu5c_C	UniProtKB/TrEMBL
	Aldolase	UniProtKB/TrEMBL
UniProt	A0A8I6GKW3	ENTREZGENE, UniProtKB/TrEMBL
	B1WC26	ENTREZGENE, UniProtKB/TrEMBL
	F7ET93	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-02	Nans	N-acetylneuraminate synthase	Nans	N-acetylneuraminic acid synthase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-11	Nans	N-acetylneuraminic acid synthase	Nans	N-acetylneuraminic acid synthase (sialic acid synthase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Nans	N-acetylneuraminic acid synthase (sialic acid synthase)	Nans_predicted	N-acetylneuraminic acid synthase (sialic acid synthase) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Nans_predicted	N-acetylneuraminic acid synthase (sialic acid synthase) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)