Advanced Search (OLGA)

Gene: Enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6) Rattus norvegicus

Analyze

Symbol:

Enpp6

Name:

ectonucleotide pyrophosphatase/phosphodiesterase 6

RGD ID:

1311645

Description:

Predicted to enable glycerophosphocholine cholinephosphodiesterase activity and glycerophosphodiester phosphodiesterase activity. Predicted to be involved in choline metabolic process and lipid metabolic process. Predicted to be located in extracellular region. Predicted to be active in plasma membrane. Orthologous to human ENPP6 (ectonucleotide pyrophosphatase/phosphodiesterase 6); PARTICIPATES IN ether lipid metabolic pathway; ether lipid metabolic pathway; INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

choline-specific glycerophosphodiester phosphodiesterase; E-NPP 6; E-NPP6; ectonucleotide pyrophosphatase/phosphodiesterase family member 6; ectonucleotide pyrophosphatase/phosphodiesterase family member 6-like; glycerophosphocholine cholinephosphodiesterase; glycerophosphocholine cholinephosphodiesterase ENPP6; GPC-Cpde; LOC100911549; LOC306460; NPP-6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ENPP6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ENPP6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ENPP6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ENPP6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ENPP6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ENPP6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NPP2	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	NPP2	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NPP1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	F13H10.5	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	T03G6.3	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T03G6.3	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	enpp6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	enpp6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	51,898,557 - 52,026,789 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	51,898,557 - 52,026,728 (-)	Ensembl				GRCr8
mRatBN7.2	16	45,165,883 - 45,294,126 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	45,169,178 - 45,294,077 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	50,579,560 - 50,693,583 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	53,939,449 - 54,060,290 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	49,218,956 - 49,332,983 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	48,315,500 - 48,437,258 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	48,315,914 - 48,437,242 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	48,028,039 - 48,150,740 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	48,396,463 - 48,516,698 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	43,179,659 - 43,298,753 (-)	NCBI		Celera
RGSC_v3.1	16	48,392,661 - 48,516,789 (-)	NCBI
Cytogenetic Map	16	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

aristolochic acid A (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP)

chlorpyrifos (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

entinostat (ISO)

fulvestrant (ISO)

GW 4064 (ISO)

lead diacetate (EXP)

methamphetamine (EXP)

N,N-diethyl-m-toluamide (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

permethrin (EXP)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

rotenone (EXP)

silicon dioxide (EXP,ISO)

tamoxifen (ISO)

trichloroethene (EXP)

trovafloxacin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

choline metabolic process (IBA,IEA,ISO,ISS)

lipid catabolic process (IEA)

lipid metabolic process (IBA,IEA,ISO,ISS)

Cellular Component

extracellular region (IEA,ISO)

plasma membrane (IBA,IEA,ISO,ISS)

side of membrane (IEA)

Molecular Function

glycerophosphocholine cholinephosphodiesterase activity (IEA,ISO,ISS)

glycerophosphodiester phosphodiesterase activity (IBA,IEA,ISO)

hydrolase activity (IEA)

metal ion binding (IEA)

phosphoric diester hydrolase activity (IEA,ISO,ISS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ether lipid metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15788404	PMID:19056867	PMID:23376485	PMID:26888014	PMID:29476059

Genomics

Comparative Map Data

Enpp6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	51,898,557 - 52,026,789 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	51,898,557 - 52,026,728 (-)	Ensembl				GRCr8
mRatBN7.2	16	45,165,883 - 45,294,126 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	45,169,178 - 45,294,077 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	50,579,560 - 50,693,583 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	53,939,449 - 54,060,290 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	49,218,956 - 49,332,983 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	48,315,500 - 48,437,258 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	48,315,914 - 48,437,242 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	48,028,039 - 48,150,740 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	48,396,463 - 48,516,698 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	43,179,659 - 43,298,753 (-)	NCBI		Celera
RGSC_v3.1	16	48,392,661 - 48,516,789 (-)	NCBI
Cytogenetic Map	16	q11	NCBI

ENPP6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	184,088,706 - 184,217,873 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	184,088,706 - 184,221,230 (-)	Ensembl			hg38	GRCh38
GRCh37	4	185,009,859 - 185,139,026 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	185,246,853 - 185,376,013 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	185,385,008 - 185,514,168	NCBI
Celera	4	182,338,726 - 182,467,954 (-)	NCBI		Celera
Cytogenetic Map	4	q35.1	NCBI
HuRef	4	180,764,953 - 180,894,206 (-)	NCBI		HuRef
CHM1_1	4	184,986,462 - 185,115,656 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	187,432,563 - 187,561,688 (-)	NCBI		T2T-CHM13v2.0

Enpp6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	47,439,920 - 47,549,797 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	47,439,922 - 47,549,797 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	46,939,197 - 47,096,762 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	46,986,887 - 47,096,762 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	48,072,279 - 48,180,249 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	48,485,742 - 48,593,712 (+)	NCBI		MGSCv36	mm8
Celera	8	49,669,997 - 49,780,091 (+)	NCBI		Celera
Cytogenetic Map	8	B1.1	NCBI
cM Map	8	26.48	NCBI

Enpp6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	24,674,012 - 24,788,947 (+)	Ensembl
ChiLan1.0	NW_004955403	24,528,644 - 24,788,878 (+)	NCBI	ChiLan1.0	ChiLan1.0

ENPP6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	181,813,324 - 181,945,361 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	182,176,798 - 182,308,794 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	176,259,291 - 176,388,497 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	188,483,901 - 188,613,382 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	188,483,901 - 188,613,382 (-)	Ensembl			panPan2	panpan1.1

ENPP6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	46,247,121 - 46,359,683 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	46,247,541 - 46,356,579 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	46,740,776 - 46,852,776 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	48,464,581 - 48,576,564 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	48,464,610 - 48,573,422 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	46,428,949 - 46,540,950 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	47,043,141 - 47,155,346 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	47,177,087 - 47,289,467 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Enpp6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	33,029,668 - 33,137,003 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936554	4,972,982 - 5,077,092 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936554	4,972,982 - 5,077,092 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ENPP6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	45,357,816 - 45,441,134 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	45,357,805 - 45,441,133 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	51,972,092 - 52,015,300 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ENPP6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	130,058,085 - 130,183,642 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	130,060,651 - 130,182,624 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	110,312,090 - 110,437,816 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Enpp6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624769	14,858,893 - 14,989,246 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624769	14,859,023 - 14,989,240 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Enpp6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	13	40,921,611 - 41,025,932 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Enpp6
898 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	149
Count of miRNA genes:	112
Interacting mature miRNAs:	126
Transcripts:	ENSRNOT00000013005, ENSRNOT00000059401
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	44455123	89455123	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	36928782	81928782	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	41992064	86992064	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4234212	66955197	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	28468701	73468701	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	49099196	91442908	Rat
1357403	Slep4	Serum leptin concentration QTL 4	3.91		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	32361043	77361043	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4234212	53708481	Rat
631833	Sach2	Saccharin preference QTL 2	4	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake rate (CMO:0001613)	16	49757666	56898388	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	31058039	76058039	Rat
1298529	Arunc1	Aerobic running capacity QTL 1	4		exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	34398294	79398294	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	839086	66195506	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	839086	66195506	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	31885271	76885271	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	44455123	89455123	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	839086	66195506	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17730818	72536785	Rat
2301406	Kidm39	Kidney mass QTL 39		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	15905802	60905802	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	839086	52786090	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	839086	66195506	Rat

Markers in Region

D16Rat45

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	16	51,974,818 - 51,975,049 (+)	Marker Load Pipeline
mRatBN7.2	16	45,242,149 - 45,242,380 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	48,385,592 - 48,385,822	NCBI	Rnor6.0
Rnor_5.0	16	48,098,986 - 48,099,216	UniSTS	Rnor5.0
RGSC_v3.4	16	48,465,320 - 48,465,551	RGD	RGSC3.4
RGSC_v3.4	16	48,465,321 - 48,465,551	UniSTS	RGSC3.4
Celera	16	43,248,427 - 43,248,657	UniSTS
RGSC_v3.1	16	48,465,395 - 48,465,626	RGD
RH 3.4 Map	16	448.5	UniSTS
RH 3.4 Map	16	448.5	RGD
RH 2.0 Map	16	449.7	RGD
FHH x ACI Map	16	22.1698	RGD
Cytogenetic Map	16	q11	UniSTS

D16Rat129

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	16	51,973,859 - 51,974,078 (+)	Marker Load Pipeline
mRatBN7.2	16	45,241,192 - 45,241,409 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	48,384,635 - 48,384,851	NCBI	Rnor6.0
Rnor_5.0	16	48,098,029 - 48,098,245	UniSTS	Rnor5.0
RGSC_v3.4	16	48,464,363 - 48,464,580	RGD	RGSC3.4
RGSC_v3.4	16	48,464,364 - 48,464,580	UniSTS	RGSC3.4
Celera	16	43,247,488 - 43,247,686	UniSTS
RGSC_v3.1	16	48,464,438 - 48,464,655	RGD
FHH x ACI Map	16	22.1698	UniSTS
FHH x ACI Map	16	22.1698	RGD
Cytogenetic Map	16	q11	UniSTS

D16Got38

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	45,265,979 - 45,266,226 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	48,409,551 - 48,409,797	NCBI	Rnor6.0
Rnor_5.0	16	48,122,945 - 48,123,191	UniSTS	Rnor5.0
RGSC_v3.4	16	48,489,148 - 48,489,395	RGD	RGSC3.4
RGSC_v3.4	16	48,489,149 - 48,489,395	UniSTS	RGSC3.4
Celera	16	43,272,255 - 43,272,501	UniSTS
RGSC_v3.1	16	48,489,223 - 48,489,470	RGD
RH 2.0 Map	16	447.3	RGD
Cytogenetic Map	16	q11	UniSTS

D16Nkg26

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	45,274,201 - 45,274,422 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	48,417,830 - 48,418,048	NCBI	Rnor6.0
Rnor_5.0	16	48,130,882 - 48,131,100	UniSTS	Rnor5.0
RGSC_v3.4	16	48,497,657 - 48,497,875	UniSTS	RGSC3.4
Cytogenetic Map	16	q11	UniSTS

RH132371

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	45,218,546 - 45,218,750 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	48,361,992 - 48,362,195	NCBI	Rnor6.0
Rnor_5.0	16	48,075,386 - 48,075,589	UniSTS	Rnor5.0
RGSC_v3.4	16	48,441,721 - 48,441,924	UniSTS	RGSC3.4
Celera	16	43,224,963 - 43,225,166	UniSTS
RH 3.4 Map	16	451.6	UniSTS
Cytogenetic Map	16	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	11	51	133	51	50	19	44	19	6	248	126	11	109	81	72	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001415078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008771259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013005 ⟹ ENSRNOP00000013005

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	45,169,178 - 45,294,057 (-)	Ensembl
Rnor_6.0 Ensembl	16	48,315,914 - 48,437,223 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000059401 ⟹ ENSRNOP00000056157

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	45,173,248 - 45,294,077 (-)	Ensembl
Rnor_6.0 Ensembl	16	48,319,990 - 48,437,242 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111159 ⟹ ENSRNOP00000080476

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	51,898,557 - 52,026,728 (-)	Ensembl
mRatBN7.2 Ensembl	16	45,169,738 - 45,294,057 (-)	Ensembl

RefSeq Acc Id:

NM_001415078 ⟹ NP_001402007

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	51,898,557 - 52,026,728 (-)	NCBI
mRatBN7.2	16	45,165,883 - 45,294,064 (-)	NCBI

RefSeq Acc Id:

XM_008771259 ⟹ XP_008769481

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	51,905,754 - 52,026,787 (-)	NCBI
mRatBN7.2	16	45,173,080 - 45,294,124 (-)	NCBI
Rnor_6.0	16	48,319,822 - 48,437,258 (-)	NCBI

Sequence:

show sequence

GAGAGAATAGCTCCAGACTCTCCATCCTCAGTCTTTGCAAGGGCACAGCTGTGCCAGCTCACTC
CAGCAGACTCCTGGCAGCATGGCAGGAAAGCTCTGGACCTTCCTGCTGCTGTTTGGGTTCAGCT
GGGTTTGGCCAGCTTCTGCCCACCGGAAGCTCCTGGTGTTGCTCCTGGATGGTTTTCGCTCAGA
CTACATCAGTGAGGATGCCCTGGCATCCTTGCCTGGTTTCAGAGAGATCGTGAACAGAGGAGTC
AAAGTGGATTACTTGACTCCAGACTTCCCCAGCCTCTCCTATCCCAATTACTACACCCTCATGA
CCGGCCGCCACTGTGAGGTCCACCAGATGATCGGGAACTACATGTGGGATCCCAGAACCAACAA
GTCATTCGACATCGGGGTCAACCGAGACAGCCTGATGCCCCTCTGGTGGAATGGGTCAGAACCC
TTGTGGATCACTCTGATGAAAGCCAGGAGGAAGGTCTACATGTACTACTGGCCAGGCTGTGAAG
TTGAGATTCTTGGTGTCAGACCAACTTATTGCCTAGAATACAAAAATGTCCCAACAGACATCAA
CTTTGCGAATGCAGTTAGCGATGCTCTCGACTCATTAAAGAGTGGCCGAGCGGATCTAGCAGCC
ATATACCACGAACGCATTGATGTAGAAGGCCATCACTATGGCCCCTCATCACCTCAGAGAAAAG
ATGCTCTCAAAGCTGTGGACACTGTCCTGAAGTATATGACCCAGTGGATTCAGGAACGAGGCTT
GCAGAATGACCTAAACGTCATCCTTTTCTCAGACCATGGGATGACTGACATCTTCTGGATGGAT
AAAGTGATTGAGTTGAGCAAATACATCAGCCTGGATGACCTGCAGCAAGTGAAGGACCAAGGGC
CCGTTGTGAGCCTGTGGCCCGTCCCAGAAAAACACTCTGAGATATATCACAAACTCCGCACCGT
AGAACACATGACAGTGTATGAGAAAGAAGCAATACCCAACAGGTTCTATTACAAGAAAGGGAAA
TTTGTCTCTCCTTTGACCTTGGTGGCTGATGAAGGGTGGTTCATAGCAGAGAGTCGAGAGGCGC
TTCCGTTTTGGATGAACAGCACCGGCAAGCGCGAAGGCTGGCAGCACGGATGGCATGGATATGA
CAACGAGCTCATGGACATGAGAGGGATCTTCCTGGCCTTCGGACCTGCTATCTGATGTCCAGAA
AGGCTTATCAGACAGCAGTTTGCTGACAGCTGTGAGTCTCAAGGTTGACAAGATTGCTTCCTGG
AGGCTGACTCTTAAATGGCCCTACTTTGTCTAGAATATCCACCCCTGTGGGTCCATTTAAAGTC
CAACTAGAAGCTAGGATGTATTCAAGGTCGGGCTCGGAAGTGACCTAGAAACTGACTTTCAGAA
TGAGCCAGAGTGACAAGAGATATTTGTATAAAAGAAAACGTGCAGAGCCTTCCTTGATCAGATT
ATATTCCAAAGGTCTAGAAAAATCGGCAGGACCCTATGAATCTGCACATTGGAAAAAATCCCAA
GTAGTATAATGAGCACATTGCTAGAAATATACTGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAG
AGAGAGAGAGAACATTAGGGGATGAGGGAGAAGGGAGGGGACCTTCATAGCTATCAGCCATCAG
GTGACCAGGTCACAGCCACCCTTTCCATGACTGTCCTTTGCTTTATGAAATATAATCCTCATGA
CATTGACATTCCAAGGGCATATTTCTGCATGTCGATCAAAATGCTTTCTGCTCACAAAAGTCTA
CACTTTCATTCCCAATTGTGTGTTAAGTAATCTACCAGTGAGCTCCGCTTTCCTCATCCATGTG
GTGAGACCGGTAATGTCACTTCACTATTACTGTGTCTGTCCTGGTTCTCCCCCCTTACCAGGAA
ATAGTCATTAAAAGGCTGAGCTTGGAAAA

hide sequence

RefSeq Acc Id:

XM_039094524 ⟹ XP_038950452

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	51,910,659 - 52,026,789 (-)	NCBI
mRatBN7.2	16	45,178,488 - 45,294,126 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001402007	(Get FASTA)	NCBI Sequence Viewer
	XP_008769481	(Get FASTA)	NCBI Sequence Viewer
	XP_038950452	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58773	(Get FASTA)	NCBI Sequence Viewer
	B0BND0	(Get FASTA)	NCBI Sequence Viewer
	EDL78898	(Get FASTA)	NCBI Sequence Viewer
	EDL78899	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013005.5
	ENSRNOP00000080476

RefSeq Acc Id:	XP_008769481 ⟸ XM_008771259
- Peptide Label:	isoform X1
- UniProtKB:	A6JPM3 (UniProtKB/TrEMBL), D3ZRI1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGKLWTFLLLFGFSWVWPASAHRKLLVLLLDGFRSDYISEDALASLPGFREIVNRGVKVDYLT PDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPRTNKSFDIGVNRDSLMPLWWNGSEPLWITLM KARRKVYMYYWPGCEVEILGVRPTYCLEYKNVPTDINFANAVSDALDSLKSGRADLAAIYHERI DVEGHHYGPSSPQRKDALKAVDTVLKYMTQWIQERGLQNDLNVILFSDHGMTDIFWMDKVIELS KYISLDDLQQVKDQGPVVSLWPVPEKHSEIYHKLRTVEHMTVYEKEAIPNRFYYKKGKFVSPLT LVADEGWFIAESREALPFWMNSTGKREGWQHGWHGYDNELMDMRGIFLAFGPAI hide sequence

Ensembl Acc Id:

ENSRNOP00000056157 ⟸ ENSRNOT00000059401

Ensembl Acc Id:

ENSRNOP00000013005 ⟸ ENSRNOT00000013005

RefSeq Acc Id:	XP_038950452 ⟸ XM_039094524
- Peptide Label:	isoform X2
- UniProtKB:	A6JPM3 (UniProtKB/TrEMBL), D3ZRI1 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000080476 ⟸ ENSRNOT00000111159

RefSeq Acc Id:	NP_001402007 ⟸ NM_001415078
- Peptide Label:	precursor
- UniProtKB:	B0BND0 (UniProtKB/Swiss-Prot), A6JPM2 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BND0-F1-model_v2	AlphaFold	B0BND0	1-440	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700096

Promoter ID:

EPDNEW_R10617

Type:

multiple initiation site

Name:

Enpp6_1

Description:

ectonucleotide pyrophosphatase/phosphodiesterase 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	48,437,229 - 48,437,289	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311645	AgrOrtholog
BioCyc Gene	G2FUF-11387	BioCyc
Ensembl Genes	ENSRNOG00000009660	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000013005.9	UniProtKB/Swiss-Prot
	ENSRNOT00000111159	ENTREZGENE
Gene3D-CATH	3.30.1360.180	UniProtKB/Swiss-Prot
	3.40.720.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7128690	IMAGE-MGC_LOAD
InterPro	Alkaline_phosphatase_core_sf	UniProtKB/Swiss-Prot
	Phosphodiest/P_Trfase	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188080	IMAGE-MGC_LOAD
NCBI Gene	306460	ENTREZGENE
PANTHER	ECTONUCLEOTIDE PYROPHOSPHATASE/PHOSPHODIESTERASE	UniProtKB/Swiss-Prot
	PTHR10151:SF66	UniProtKB/Swiss-Prot
Pfam	Phosphodiest	UniProtKB/Swiss-Prot
PhenoGen	Enpp6	PhenoGen
RatGTEx	ENSRNOG00000009660	RatGTEx
Superfamily-SCOP	SSF53649	UniProtKB/Swiss-Prot
UniProt	A0A8I6G4L0_RAT	UniProtKB/TrEMBL
	A6JPM2	ENTREZGENE, UniProtKB/TrEMBL
	A6JPM3	ENTREZGENE, UniProtKB/TrEMBL
	B0BND0	ENTREZGENE
	D3ZRI1	ENTREZGENE
	ENPP6_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Enpp6	ectonucleotide pyrophosphatase/phosphodiesterase 6	LOC100911549	ectonucleotide pyrophosphatase/phosphodiesterase family member 6-like	Data merged from RGD:6492512	737654	PROVISIONAL
2012-07-05	LOC100911549	ectonucleotide pyrophosphatase/phosphodiesterase family member 6-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-04-30	Enpp6	ectonucleotide pyrophosphatase/phosphodiesterase 6	Enpp6_predicted	ectonucleotide pyrophosphatase/phosphodiesterase 6 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Enpp6_predicted	ectonucleotide pyrophosphatase/phosphodiesterase 6 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)