Advanced Search (OLGA)

Gene: Rxfp3 (relaxin family peptide receptor 3) Rattus norvegicus

Analyze

Symbol:

Rxfp3

Name:

relaxin family peptide receptor 3

RGD ID:

1311550

Description:

Predicted to enable galanin receptor activity. Predicted to be involved in neuropeptide signaling pathway and positive regulation of cytokinesis. Predicted to act upstream of or within phospholipase C-activating G protein-coupled receptor signaling pathway. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human RXFP3 (relaxin family peptide receptor 3); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G-protein coupled receptor SALPR; GPCR135; LOC294807; relaxin 3 receptor 1; relaxin-3 receptor 1; relaxin-3/INSL7 receptor 1; relaxin/insulin-like family peptide receptor 3; RGD1311550; Rln3r1; Salpr; similar to Somatostatin- and angiogenin-like peptide receptor (G-protein coupled receptor SALPR)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RXFP3 (relaxin family peptide receptor 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Rxfp3 (relaxin family peptide receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rxfp3 (relaxin family peptide receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RXFP3 (relaxin family peptide receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RXFP3 (relaxin family peptide receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rxfp3 (relaxin family peptide receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RXFP3 (relaxin family peptide receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RXFP3 (relaxin family peptide receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rxfp3 (relaxin family peptide receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rxfp3 (relaxin family peptide receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RXFP3 (relaxin family peptide receptor 3)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rxfp3 (relaxin family peptide receptor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rxfp3 (relaxin family peptide receptor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-27	Alliance	DIOPT (OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	rxfp3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	rxfp4	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	61,730,376 - 61,731,806 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	61,726,972 - 61,732,417 (-)	Ensembl				GRCr8
mRatBN7.2	2	60,003,256 - 60,004,686 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	60,003,256 - 60,004,686 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	67,114,222 - 67,115,652 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	65,235,735 - 65,237,165 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	60,237,116 - 60,238,546 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	61,006,337 - 61,007,767 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	61,006,337 - 61,007,767 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	83,676,999 - 83,678,429 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	60,390,777 - 60,392,207 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	58,680,072 - 58,681,502 (+)	NCBI		Celera
RGSC_v3.1	2	60,319,009 - 60,320,440 (-)	NCBI
Cytogenetic Map	2	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP,ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

diiodine (ISO)

folic acid (ISO)

glycidol (EXP)

methimazole (EXP)

paracetamol (ISO)

propiconazole (EXP)

sulfadimethoxine (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IEA)

phospholipase C-activating G protein-coupled receptor signaling pathway (ISO)

positive regulation of cytokinesis (ISO)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IEA)

Molecular Function

G protein-coupled peptide receptor activity (IEA,ISO)

G protein-coupled receptor activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15367576	PMID:15845093	PMID:16378626	PMID:16764952	PMID:17071007	PMID:22888021	PMID:24297931	PMID:24629399	PMID:24837581	PMID:25313002	PMID:27146679	PMID:27193232
PMID:28726252	PMID:28776188	PMID:31568840	PMID:32532885	PMID:38788901	PMID:38970242

Genomics

Comparative Map Data

Rxfp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	61,730,376 - 61,731,806 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	61,726,972 - 61,732,417 (-)	Ensembl				GRCr8
mRatBN7.2	2	60,003,256 - 60,004,686 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	60,003,256 - 60,004,686 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	67,114,222 - 67,115,652 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	65,235,735 - 65,237,165 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	60,237,116 - 60,238,546 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	61,006,337 - 61,007,767 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	61,006,337 - 61,007,767 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	83,676,999 - 83,678,429 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	60,390,777 - 60,392,207 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	58,680,072 - 58,681,502 (+)	NCBI		Celera
RGSC_v3.1	2	60,319,009 - 60,320,440 (-)	NCBI
Cytogenetic Map	2	q16	NCBI

RXFP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	33,936,386 - 33,938,918 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	33,936,386 - 33,938,918 (+)	Ensembl			hg38	GRCh38
GRCh37	5	33,936,491 - 33,939,023 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	33,972,246 - 33,974,099 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	33,972,247 - 33,974,099	NCBI
Celera	5	33,824,981 - 33,827,513 (+)	NCBI		Celera
Cytogenetic Map	5	p13.2	NCBI
HuRef	5	33,914,512 - 33,917,044 (+)	NCBI		HuRef
CHM1_1	5	33,938,118 - 33,940,649 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	34,058,309 - 34,060,841 (+)	NCBI		T2T-CHM13v2.0

Rxfp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	11,033,803 - 11,038,054 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	11,033,803 - 11,038,077 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	11,033,717 - 11,037,968 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	11,033,717 - 11,037,991 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	10,963,472 - 10,967,723 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	10,978,442 - 10,982,693 (-)	NCBI		MGSCv36	mm8
Celera	15	10,825,991 - 10,830,242 (-)	NCBI		Celera
Cytogenetic Map	15	A1	NCBI
cM Map	15	5.42	NCBI

Rxfp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955426	19,493,965 - 19,495,365 (+)	Ensembl
ChiLan1.0	NW_004955426	19,493,990 - 19,497,074 (+)	NCBI	ChiLan1.0	ChiLan1.0

RXFP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	76,367,113 - 76,373,676 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	74,520,744 - 74,527,307 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	76,401,718 - 76,407,125 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	81,790,293 - 81,792,817 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	81,791,059 - 81,792,468 (-)	Ensembl			panPan2	panpan1.1

RXFP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	73,872,170 - 73,877,475 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	73,872,246 - 73,873,661 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	73,487,941 - 73,493,181 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	74,378,606 - 74,383,844 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	4	74,124,554 - 74,129,794 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	74,248,590 - 74,253,833 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	74,782,753 - 74,787,985 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rxfp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	224,228,232 - 224,231,353 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936518	7,142,174 - 7,143,580 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936518	7,140,512 - 7,143,656 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RXFP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	19,950,634 - 19,952,043 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	19,948,896 - 19,955,163 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	20,709,683 - 20,713,890 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RXFP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	33,169,286 - 33,174,386 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	33,170,977 - 33,172,386 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666071	23,465,650 - 23,469,111 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rxfp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624759	20,703,966 - 20,708,895 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rxfp3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	169,719,637 - 169,721,562 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rxfp3
6 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	90
Interacting mature miRNAs:	97
Transcripts:	ENSRNOT00000031693
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	61556902	106556902	Rat
6480225	Gdil1	Gastrointestinal dilation QTL 1			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	58388201	77302351	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	61051883	104684275	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	24117813	69117813	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	36750344	81750344	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	61051541	105724065	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	22038044	67038044	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	28889991	73889991	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	44904355	85286097	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	44537979	112567334	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	61051541	105724065	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	83465677	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	51266859	96266859	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	60861391	105861391	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	18227137	63227137	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	36868643	81868643	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	44904355	89904355	Rat
1582246	Cm60	Cardiac mass QTL 60	5.8		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	33269996	78269996	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	73652666	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
2	3	12	103	26	28	12	4	12	1	42	24	4	101	4	46	16	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008310	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY633763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY633764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031693 ⟹ ENSRNOP00000032501

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	60,003,256 - 60,004,686 (-)	Ensembl
Rnor_6.0 Ensembl	2	61,006,337 - 61,007,767 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000156095 ⟹ ENSRNOP00000107155

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	61,726,972 - 61,732,417 (-)	Ensembl

RefSeq Acc Id:

NM_001008310 ⟹ NP_001008311

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	61,730,376 - 61,731,806 (-)	NCBI
mRatBN7.2	2	60,003,256 - 60,004,686 (-)	NCBI
Rnor_6.0	2	61,006,337 - 61,007,767 (-)	NCBI
Rnor_5.0	2	83,676,999 - 83,678,429 (+)	NCBI
RGSC_v3.4	2	60,390,777 - 60,392,207 (-)	RGD
Celera	2	58,680,072 - 58,681,502 (+)	RGD

Sequence:

show sequence

ATGCCCAAAGCGCACCTGAGCATGCAAGTGGCTTCTGCAACCACCGCAGCCCCCATGAGTAAGG
CAGCTGCGGGTGATGAGCTCTCCGGATTCTTCGGCCTGATCCCAGACTTGCTGGAGGTTGCCAA
CAGGAGCAGCAATGCGTCGCTGCAGCTTCAGGACTTGTGGTGGGAGCTGGGGCTGGAGTTGCCC
GACGGTGCGGCGCCTGGGCATCCCCCGGGCAGCGGTGGGGCAGAGAGCGCGGACACAGAGGCCA
GGGTACGGATCCTCATCAGCGCCGTTTACTGGGTGGTTTGTGCCCTGGGACTGGCTGGCAACCT
GCTGGTTCTCTACCTGATGAAGAGCAAACAGGGCTGGCGCAAATCCTCCATTAACCTCTTTGTC
ACTAACCTGGCGCTGACTGACTTTCAGTTTGTGCTCACTCTGCCCTTCTGGGCGGTGGAGAACG
CACTAGATTTCAAGTGGCCCTTTGGCAAGGCCATGTGTAAGATCGTATCTATGGTGACATCCAT
GAACATGTATGCCAGCGTCTTCTTTCTCACTGCTATGAGTGTGGCGCGCTACCACTCGGTGGCC
TCAGCTCTCAAGAGCCATCGGACCCGCGGGCATGGCCGTGGCGACTGCTGCGGCCAGAGCTTGG
GGGAGAGCTGCTGTTTCTCAGCCAAGGTGCTGTGTGGATTGATCTGGGCTTCTGCCGCGATAGC
TTCGCTGCCCAATGTCATTTTTTCTACCACCATCAATGTGTTGGGCGAGGAGCTGTGCCTCATG
CACTTTCCGGACAAGCTCCTGGGTTGGGACCGGCAGTTCTGGCTGGGTTTGTACCACCTGCAGA
AGGTGCTGCTGGGCTTCCTGCTGCCGCTGAGCATCATCAGTTTGTGTTACCTGTTGCTCGTGCG
CTTCATCTCCGACCGCCGCGTAGTGGGGACAACGGATGGAGCAACAGCGCCTGGGGGGAGCCTG
AGTACAGCCGGCGCTCGGAGACGCTCCAAGGTCACCAAGTCGGTGACCATCGTAGTCCTTTCCT
TCTTCTTATGTTGGCTGCCCAACCAAGCGCTCACCACCTGGAGCATCCTCATCAAGTTCAACGT
AGTGCCCTTCAGTCAGGAGTACTTTCAGTGCCAAGTGTACGCGTTCCCAGTCAGCGTGTGCCTG
GCACACTCCAACAGCTGCCTCAACCCCATCCTCTACTGCTTAGTGCGCCGCGAGTTCCGCAAGG
CGCTCAAGAACCTGCTGTGGCGTATAGCATCGCCTTCGCTCACCAGCATGCGCCCCTTCACCGC
CACCACCAAGCCAGAACCTGAAGATCACGGGCTGCAGGCCCTGGCGCCACTTAATGCTACTGCA
GAGCCTGACCTGATCTACTATCCACCCGGTGTGGTGGTCTACAGCGGAGGTCGCTACGACCTTC
TCCCTAGCAGCTCTGCCTACTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001008311	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAU93889	(Get FASTA)	NCBI Sequence Viewer
	AAU93890	(Get FASTA)	NCBI Sequence Viewer
	EDL82980	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000107155
	ENSRNOP00000107155.1

RefSeq Acc Id:

NP_001008311 ⟸ NM_001008310

- UniProtKB:

Q5Y986 (UniProtKB/TrEMBL), A6KJS0 (UniProtKB/TrEMBL), Q5Y987 (UniProtKB/TrEMBL), F7EK20 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPKAHLSMQVASATTAAPMSKAAAGDELSGFFGLIPDLLEVANRSSNASLQLQDLWWELGLELP
DGAAPGHPPGSGGAESADTEARVRILISAVYWVVCALGLAGNLLVLYLMKSKQGWRKSSINLFV
TNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVARYHSVA
SALKSHRTRGHGRGDCCGQSLGESCCFSAKVLCGLIWASAAIASLPNVIFSTTINVLGEELCLM
HFPDKLLGWDRQFWLGLYHLQKVLLGFLLPLSIISLCYLLLVRFISDRRVVGTTDGATAPGGSL
STAGARRRSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNVVPFSQEYFQCQVYAFPVSVCL
AHSNSCLNPILYCLVRREFRKALKNLLWRIASPSLTSMRPFTATTKPEPEDHGLQALAPLNATA
EPDLIYYPPGVVVYSGGRYDLLPSSSAY

hide sequence

Ensembl Acc Id:

ENSRNOP00000032501 ⟸ ENSRNOT00000031693

Ensembl Acc Id:

ENSRNOP00000107155 ⟸ ENSRNOT00000156095

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5Y986-F1-model_v2	AlphaFold	Q5Y986	1-476	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311550	AgrOrtholog
BioCyc Gene	G2FUF-54066	BioCyc
Ensembl Genes	ENSRNOG00000023126	Ensembl
	ENSRNOG00000083723	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000156095	ENTREZGENE
	ENSRNOT00000156095.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR1	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
KEGG Report	rno:294807	UniProtKB/TrEMBL
NCBI Gene	294807	ENTREZGENE
PANTHER	CELL ADHESION MOLECULE	UniProtKB/TrEMBL
	RELAXIN FAMILY PEPTIDE_INSL5 RECEPTOR 4	UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/TrEMBL
PhenoGen	Rxfp3	PhenoGen
PRINTS	FMETLEUPHER	UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000023126	RatGTEx
	ENSRNOG00000083723	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6KJS0	ENTREZGENE, UniProtKB/TrEMBL
	F7EK20	ENTREZGENE, UniProtKB/TrEMBL
	Q5Y986	ENTREZGENE
	Q5Y987	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	Q5Y986	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-03-01	Rxfp3	relaxin family peptide receptor 3	Rxfp3	relaxin/insulin-like family peptide receptor 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-20	Rxfp3	relaxin/insulin-like family peptide receptor 3	Rxfp3	relaxin family peptide receptor 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Rxfp3	relaxin family peptide receptor 3	Rln3r1	relaxin 3 receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Rln3r1	relaxin 3 receptor 1	RGD1311550	similar to Somatostatin- and angiogenin-like peptide receptor (G-protein coupled receptor SALPR)	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1311550	similar to Somatostatin- and angiogenin-like peptide receptor (G-protein coupled receptor SALPR)	RGD1311550_predicted	similar to Somatostatin- and angiogenin-like peptide receptor (G-protein coupled receptor SALPR) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1311550_predicted	similar to Somatostatin- and angiogenin-like peptide receptor (G-protein coupled receptor SALPR) (predicted)	LOC294807_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC294807_predicted	similar to Somatostatin- and angiogenin-like peptide receptor (G-protein coupled receptor SALPR) (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message