Advanced Search (OLGA)

Gene: Cmas (cytidine monophosphate N-acetylneuraminic acid synthetase) Rattus norvegicus

Analyze

Symbol:

Cmas

Name:

cytidine monophosphate N-acetylneuraminic acid synthetase

RGD ID:

1310911

Description:

Predicted to enable N-acylneuraminate cytidylyltransferase activity. Predicted to be involved in CMP-N-acetylneuraminate biosynthetic process; N-acetylneuraminate metabolic process; and glycosylation. Predicted to be located in nucleus. Predicted to be active in nucleoplasm. Orthologous to human CMAS (cytidine monophosphate N-acetylneuraminic acid synthetase); PARTICIPATES IN amino sugar metabolic pathway; french type sialuria pathway; sialic acid storage disease pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CMP-N-acetylneuraminic acid synthase; CMP-N-acetylneuraminic acid synthetase; CMP-NeuNAc synthase; CMP-NeuNAc synthetase; cytidine 5'-monophosphate N-acetylneuraminic acid synthetase; cytidine monophospho-N-acetylneuraminic acid synthetase; LOC312826; MGC105806; N-acylneuraminate cytidylyltransferase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	177,449,801 - 177,468,117 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	177,449,732 - 177,476,291 (+)	Ensembl				GRCr8
mRatBN7.2	4	175,718,808 - 175,737,128 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	175,718,808 - 175,737,125 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	182,013,798 - 182,032,139 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	177,798,073 - 177,816,414 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	176,418,640 - 176,436,981 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	176,994,129 - 177,012,445 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	176,994,129 - 177,012,444 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	241,203,361 - 241,221,676 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	180,650,927 - 180,669,243 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	164,249,097 - 164,267,377 (+)	NCBI		Celera
RGSC_v3.1	4	180,896,050 - 180,914,366 (+)	NCBI
Cytogenetic Map	4	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

focal segmental glomerulosclerosis (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-acetamidofluorene (EXP)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

aceneuramic acid (ISO)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

CMP-N-acetyl-beta-neuraminic acid (ISO)

cobalt dichloride (ISO)

crocidolite asbestos (ISO)

dextran sulfate (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

diuron (EXP)

flurbiprofen (ISO)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

inulin (ISO)

ivermectin (ISO)

methidathion (ISO)

methoxychlor (EXP)

mono(2-ethylhexyl) phthalate (ISO)

N-acetylmannosamine (ISO)

N-acetylneuraminic acid (ISO)

nefazodone (EXP)

Nutlin-3 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

rac-lactic acid (ISO)

rotenone (EXP)

sodium arsenite (ISO)

Soman (EXP)

titanium dioxide (ISO)

tributylstannane (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

CMP-N-acetylneuraminate biosynthetic process (IEA,ISO)

N-acetylneuraminate metabolic process (IEA,ISO)

Cellular Component

nucleolus (IEA,ISO)

nucleoplasm (ISO)

nucleus (IEA)

Molecular Function

N-acylneuraminate cytidylyltransferase activity (IBA,IEA,ISO)

nucleotidyltransferase activity (IEA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

amino sugar metabolic pathway (IEA,ISO)

french type sialuria pathway (ISO)

nucleotide sugar metabolic pathway (IEA)

sialic acid storage disease pathway (ISO)

Tay-Sachs disease pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:19946888	PMID:21630459

Genomics

Comparative Map Data

Cmas
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	177,449,801 - 177,468,117 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	177,449,732 - 177,476,291 (+)	Ensembl				GRCr8
mRatBN7.2	4	175,718,808 - 175,737,128 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	175,718,808 - 175,737,125 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	182,013,798 - 182,032,139 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	177,798,073 - 177,816,414 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	176,418,640 - 176,436,981 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	176,994,129 - 177,012,445 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	176,994,129 - 177,012,444 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	241,203,361 - 241,221,676 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	180,650,927 - 180,669,243 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	164,249,097 - 164,267,377 (+)	NCBI		Celera
RGSC_v3.1	4	180,896,050 - 180,914,366 (+)	NCBI
Cytogenetic Map	4	q44	NCBI

CMAS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	22,046,218 - 22,065,668 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	22,046,174 - 22,065,674 (+)	Ensembl			hg38	GRCh38
GRCh37	12	22,199,152 - 22,218,602 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	22,090,426 - 22,109,869 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	22,090,425 - 22,109,869	NCBI
Celera	12	27,353,627 - 27,373,064 (+)	NCBI		Celera
Cytogenetic Map	12	p12.1	NCBI
HuRef	12	21,972,423 - 21,991,850 (+)	NCBI		HuRef
CHM1_1	12	22,164,047 - 22,183,534 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	21,924,274 - 21,943,724 (+)	NCBI		T2T-CHM13v2.0

Cmas
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	142,702,468 - 142,721,440 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	142,702,412 - 142,721,440 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	142,756,686 - 142,775,714 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	142,756,686 - 142,775,714 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	142,705,206 - 142,724,234 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	142,713,995 - 142,732,930 (+)	NCBI		MGSCv36	mm8
Celera	6	145,818,239 - 145,837,265 (+)	NCBI		Celera
Cytogenetic Map	6	G2	NCBI
cM Map	6	74.66	NCBI

Cmas
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	17,575,469 - 17,599,859 (+)	Ensembl
ChiLan1.0	NW_004955413	17,575,469 - 17,596,379 (+)	NCBI	ChiLan1.0	ChiLan1.0

CMAS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	74,738,425 - 74,757,537 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	74,734,823 - 74,753,931 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	64,234,241 - 64,253,306 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	66,838,670 - 66,857,774 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	66,838,670 - 66,857,774 (-)	Ensembl			panPan2	panpan1.1

CMAS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	25,097,907 - 25,117,003 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	25,098,091 - 25,116,965 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	21,243,508 - 21,262,605 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	25,317,491 - 25,336,605 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	25,317,494 - 25,336,619 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	25,116,424 - 25,135,532 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	25,139,768 - 25,158,852 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	21,412,861 - 21,431,958 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cmas
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	86,955,025 - 86,972,811 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936548	4,877,530 - 4,895,822 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936548	4,877,753 - 4,895,768 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CMAS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	51,438,020 - 51,458,615 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	51,438,175 - 51,458,531 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	54,719,668 - 54,740,011 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CMAS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	21,896,607 - 21,919,211 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	21,896,630 - 21,915,657 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666069	13,226,303 - 13,245,314 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cmas
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	16,712,660 - 16,732,399 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624752	16,712,878 - 16,731,937 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cmas
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	523,597 - 542,285 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cmas
143 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	41
Count of miRNA genes:	38
Interacting mature miRNAs:	38
Transcripts:	ENSRNOT00000018734
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	157292416	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1300109	Rf13	Renal function QTL 13	3.91		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	4	176806581	181925369	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	160623982	184426481	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat

Markers in Region

RH131050

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	175,736,819 - 175,737,039 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	177,012,137 - 177,012,356	NCBI	Rnor6.0
Rnor_5.0	4	241,221,368 - 241,221,587	UniSTS	Rnor5.0
RGSC_v3.4	4	180,668,935 - 180,669,154	UniSTS	RGSC3.4
Celera	4	164,267,069 - 164,267,288	UniSTS
RH 3.4 Map	4	1044.5	UniSTS
Cytogenetic Map	4	q44	UniSTS

CMAS

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	175,726,158 - 175,726,550 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	177,001,480 - 177,001,871	NCBI	Rnor6.0
Rnor_5.0	4	241,210,712 - 241,211,103	UniSTS	Rnor5.0
RGSC_v3.4	4	180,658,278 - 180,658,669	UniSTS	RGSC3.4
Celera	4	164,256,448 - 164,256,839	UniSTS
Cytogenetic Map	4	q44	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018734 ⟹ ENSRNOP00000018734

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	177,449,732 - 177,468,118 (+)	Ensembl
mRatBN7.2 Ensembl	4	175,718,808 - 175,737,125 (+)	Ensembl
Rnor_6.0 Ensembl	4	176,994,129 - 177,012,444 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000129445 ⟹ ENSRNOP00000102303

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	177,449,732 - 177,476,291 (+)	Ensembl

RefSeq Acc Id:

NM_001009419 ⟹ NP_001009419

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	177,449,801 - 177,468,117 (+)	NCBI
mRatBN7.2	4	175,718,808 - 175,737,128 (+)	NCBI
Rnor_6.0	4	176,994,129 - 177,012,445 (+)	NCBI
Rnor_5.0	4	241,203,361 - 241,221,676 (+)	NCBI
RGSC_v3.4	4	180,650,927 - 180,669,243 (+)	RGD
Celera	4	164,249,097 - 164,267,377 (+)	RGD

Sequence:

show sequence

GGAAGATGGACGCGCTGGAGAAGGGGGCCGCCACGTCGGGGCCCGCCCCGCGCGGACGGCCGTC
CCGGGGCCGGCCCCCGAAGCTACAGCGCAGCCGGGGCGCGGGGCGAGGCCTAGAGAAGCCGCCG
CACCTGGCAGCGCTGGTGCTGGCCCGCGGCGGCAGCAAAGGCATCCCACTGAAGAACATCAAGC
GCCTGGCGGGGGTTCCGCTCATTGGCTGGGTCCTGCGCGCAGCCCTGGACGCGGGTGTCTTCCA
GAGTGTGTGGGTTTCAACAGACCATGATGAAATTGAGAACGTGGCCAAACAGTTTGGTGCCCAG
GTTCACCGAAGAAGTTCTGAAACGTCCAAAGACAGCTCTACCTCACTAGATGCCATCGTAGAAT
TCCTGAACTATCACAATGAGGTTGACATTGTGGGAAATATCCAAGCTACATCTCCATGTTTACA
TCCCACGGACCTCCAGAAAGTTGCAGAAATGATCCGAGAAGAAGGATATGACTCTGTCTTCTCC
GTTGTGAGGCGCCATCAGTTTCGATGGAGTGAAATTCAGAAAGGAGTTCGTGAAGTGACCGAGC
CTCTCAACCTGAACCCAGCTAAGCGGCCTCGTCGACAGGACTGGGATGGAGAGCTGTACGAAAA
CGGCTCGTTCTACTTTGCTAAGAGACACTTGATAGAGATGGGCTACTTACAGGGTGGGAAAATG
GCATATTATGAAATGCGAGCTGAGCACAGTGTGGACATAGACGTGGACATCGATTGGCCGATCG
CAGAGCAAAGAGTTCTGAGATTTGGCTATTTTGGGAAAGAGAAGCTGAAGGAGATAAAGCTTTT
GGTGTGTAATATTGATGGATGTCTCACCAATGGTCACATTTACGTATCAGGAGACCAAAAAGAA
ATAATATCTTACGATGTGAAAGACGCTATTGGCATAAGTTTACTAAAGAAAAGTGGCATTGAGG
TGAGGCTCATCTCAGAAAGGGCCTGCTCCAAGCAGACGCTCTCCGCCTTAAAGCTGGACTGTAA
AACGGAAGTCAGTGTGTCAGACAAGCTGGCCATCGTGGATGAGTGGAGGAAGGAGATGGGCCTG
TGCTGGAAAGAAGTGGCCTATCTCGGCAATGAGGTGTCCGATGAGGAGTGTCTGAAGAGAGCGG
GCCTGAGCGCCGTGCCTGCTGACGCCTGCTCCAGGGCCCAAAAGGCTGTGGGCTACATCTGCAA
ATGCAACGGGGGCCGTGGAGCCATCCGGGAGTTTGCAGAACACATTTTCCTCCTGTTAGAAAAG
GTTAATAACTCATGCCAAAAATAGAAGTGGTTGTAGTGTGGGGGAAGGGAGAACGAAGCCTTTT
CCAGCCACTTTGCTTTGTTTTTGATCAAGTCTCGAAGTGTAATCTGCTGCGAGTGATCAGATCT
GTAAGATACCTTACTCTTCTCAAAGCTGAGTTTTTTCAAATCATTGTTCCAGAATCCACGACAT
AATTATGTCTGCTTTCCTCTTGATGCAAGGTAATTTACTGAGGGACCGACCGAGTCTTTCTCGG
ACCTCTAGCGAATACAAGTCAGACATCATAAACAATCAACTTTGTATTGTGCCCTGTCAAACTG
TGTTTGTGTGGTGTTAATGATACTGGGATTTTATTTATTTAAGGCAGTGTGTCTGGTAAGACAC
ACCTGTGTTAATAAACTTACAGTTCACAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009419	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87599	(Get FASTA)	NCBI Sequence Viewer
	EDM01475	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018734
GenBank Protein	P69060	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009419 ⟸ NM_001009419

- UniProtKB:

P69060 (UniProtKB/Swiss-Prot), Q5M963 (UniProtKB/TrEMBL), F7F0E0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDALEKGAATSGPAPRGRPSRGRPPKLQRSRGAGRGLEKPPHLAALVLARGGSKGIPLKNIKRL
AGVPLIGWVLRAALDAGVFQSVWVSTDHDEIENVAKQFGAQVHRRSSETSKDSSTSLDAIVEFL
NYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPL
NLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAE
QRVLRFGYFGKEKLKEIKLLVCNIDGCLTNGHIYVSGDQKEIISYDVKDAIGISLLKKSGIEVR
LISERACSKQTLSALKLDCKTEVSVSDKLAIVDEWRKEMGLCWKEVAYLGNEVSDEECLKRAGL
SAVPADACSRAQKAVGYICKCNGGRGAIREFAEHIFLLLEKVNNSCQK

hide sequence

Ensembl Acc Id:

ENSRNOP00000018734 ⟸ ENSRNOT00000018734

Ensembl Acc Id:

ENSRNOP00000102303 ⟸ ENSRNOT00000129445

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P69060-F1-model_v2	AlphaFold	P69060	1-432	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693492

Promoter ID:

EPDNEW_R4016

Type:

initiation region

Name:

Cmas_1

Description:

cytidine monophosphate N-acetylneuraminic acid synthetase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	176,994,105 - 176,994,165	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310911	AgrOrtholog
BioCyc Gene	G2FUF-42488	BioCyc
BioCyc Pathway	PWY-6138 [CMP-N-acetylneuraminate biosynthesis I (eukaryotes)]	BioCyc
BioCyc Pathway Image	PWY-6138	BioCyc
Ensembl Genes	ENSRNOG00000013816	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000018734	ENTREZGENE
Gene3D-CATH	3.40.50.1000	UniProtKB/Swiss-Prot
	Spore Coat Polysaccharide Biosynthesis Protein SpsA, Chain A	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7313414	IMAGE-MGC_LOAD
InterPro	CMP-NeuNAc_synthase	UniProtKB/Swiss-Prot
	Cytidylyl_trans	UniProtKB/Swiss-Prot
	HAD-like_sf	UniProtKB/Swiss-Prot
	HAD_sf	UniProtKB/Swiss-Prot
	Nucleotide-diphossugar_trans	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105806	IMAGE-MGC_LOAD
NCBI Gene	312826	ENTREZGENE
PANTHER	HAD SUPERFAMILY MEMBERS CMAS AND KDSC	UniProtKB/Swiss-Prot
	N-ACYLNEURAMINATE CYTIDYLYLTRANSFERASE	UniProtKB/Swiss-Prot
Pfam	CTP_transf_3	UniProtKB/Swiss-Prot
PhenoGen	Cmas	PhenoGen
RatGTEx	ENSRNOG00000013816	RatGTEx
Superfamily-SCOP	SSF53448	UniProtKB/Swiss-Prot
	SSF56784	UniProtKB/Swiss-Prot
UniProt	A0ABK0L1J0_RAT	UniProtKB/TrEMBL
	F7F0E0	ENTREZGENE, UniProtKB/TrEMBL
	NEUA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5M963	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-09	Cmas	cytidine monophosphate N-acetylneuraminic acid synthetase	Cmas	cytidine monophospho-N-acetylneuraminic acid synthetase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Cmas	cytidine monophospho-N-acetylneuraminic acid synthetase	Cmas_predicted	cytidine monophospho-N-acetylneuraminic acid synthetase (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Cmas_predicted	cytidine monophospho-N-acetylneuraminic acid synthetase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - MGI

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - MGI

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways