Advanced Search (OLGA)

Gene: Maea (macrophage erythroblast attacher, E3 ubiquitin ligase) Rattus norvegicus

Analyze

Symbol:

Maea

Name:

macrophage erythroblast attacher, E3 ubiquitin ligase

RGD ID:

1309877

Description:

Predicted to enable actin binding activity. Predicted to contribute to ubiquitin-protein transferase activity. Predicted to be involved in cell adhesion; negative regulation of myeloid cell apoptotic process; and proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within cytoskeleton organization and enucleate erythrocyte development. Predicted to be located in cytoskeleton; nuclear lumen; and plasma membrane. Predicted to be part of GID complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human MAEA (macrophage erythroblast attacher, E3 ubiquitin ligase); INTERACTS WITH 17alpha-ethynylestradiol; bisphenol A; gentamycin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

E3 ubiquitin-protein transferase MAEA; LOC298982; macrophage erythroblast attacher; MGC93683

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MAEA (macrophage erythroblast attacher, E3 ubiquitin ligase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Maea (macrophage erythroblast attacher)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Maea (macrophage erythroblast attacher, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MAEA (macrophage erythroblast attacher, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MAEA (macrophage erythroblast attacher, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Maea (macrophage erythroblast attacher, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MAEA (macrophage erythroblast attacher, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MAEA (macrophage erythroblast attacher, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Maea (macrophage erythroblast attacher, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Maea (macrophage erythroblast attacher, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MAEA (macrophage erythroblast attacher, E3 ubiquitin ligase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MAEA (macrophage erythroblast attacher, E3 ubiquitin ligase)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Maea (macrophage erythroblast attacher)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Maea (macrophage erythroblast attacher)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	maea (macrophage erythroblast attacher)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	maea (macrophage erythroblast attacher)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31357	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31357	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	FYV10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	FYV10	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	maea-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	maea-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	maea	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	maea	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	81,581,784 - 81,615,246 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	81,581,785 - 81,615,202 (-)	Ensembl				GRCr8
mRatBN7.2	14	77,357,261 - 77,390,683 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	77,357,264 - 77,390,671 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	81,808,960 - 81,842,384 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	83,049,511 - 83,082,935 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	79,494,839 - 79,528,263 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	82,664,248 - 82,697,673 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	82,664,249 - 82,697,673 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	83,349,564 - 83,383,727 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	83,124,774 - 83,158,198 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	76,276,552 - 76,309,970 (-)	NCBI		Celera
RGSC_v3.1	14	83,127,164 - 83,160,588 (+)	NCBI
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

7,12-dimethyltetraphene (ISO)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

asbestos (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

crocidolite asbestos (ISO)

cyproconazole (ISO)

diuron (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenthion (ISO)

folic acid (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

iron dichloride (ISO)

kojic acid (ISO)

lead diacetate (ISO)

methidathion (ISO)

methylseleninic acid (ISO)

nitrates (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell adhesion (IEA,ISO)

cell division (IEA)

cytoskeleton organization (ISO)

enucleate erythrocyte development (ISO)

erythrocyte development (ISO)

erythrocyte maturation (IEA)

negative regulation of myeloid cell apoptotic process (IEA,ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA,IEA)

Cellular Component

actin cytoskeleton (IEA,ISO)

actomyosin contractile ring (IEA,ISO)

cytoplasm (IBA,IEA)

cytoskeleton (IEA,ISO)

GID complex (IBA)

nuclear matrix (IEA,ISO)

nucleoplasm (IEA,ISO,ISS)

nucleus (IBA,IEA,ISO)

plasma membrane (IEA,ISO)

spindle (IEA,ISO)

ubiquitin ligase complex (IEA,ISO)

Molecular Function

actin binding (IEA,ISO)

metal ion binding (IEA)

protein binding (ISO)

transferase activity (IEA)

ubiquitin protein ligase activity (IEA)

ubiquitin-protein transferase activity (IBA,IEA)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9763581	PMID:12477932	PMID:16510120	PMID:16707498	PMID:17467196	PMID:24143168	PMID:29911972

Genomics

Comparative Map Data

Maea
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	81,581,784 - 81,615,246 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	81,581,785 - 81,615,202 (-)	Ensembl				GRCr8
mRatBN7.2	14	77,357,261 - 77,390,683 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	77,357,264 - 77,390,671 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	81,808,960 - 81,842,384 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	83,049,511 - 83,082,935 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	79,494,839 - 79,528,263 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	82,664,248 - 82,697,673 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	82,664,249 - 82,697,673 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	83,349,564 - 83,383,727 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	83,124,774 - 83,158,198 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	76,276,552 - 76,309,970 (-)	NCBI		Celera
RGSC_v3.1	14	83,127,164 - 83,160,588 (+)	NCBI
Cytogenetic Map	14	q21	NCBI

MAEA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	1,289,891 - 1,340,137 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	1,289,876 - 1,340,147 (+)	Ensembl			hg38	GRCh38
GRCh37	4	1,283,679 - 1,333,925 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	1,273,672 - 1,323,925 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	1,273,542 - 1,323,721	NCBI
Celera	4	1,215,633 - 1,265,565 (+)	NCBI		Celera
Cytogenetic Map	4	p16.3	NCBI
HuRef	4	1,250,956 - 1,301,457 (+)	NCBI		HuRef
CHM1_1	4	1,282,541 - 1,333,721 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	1,288,439 - 1,338,753 (+)	NCBI		T2T-CHM13v2.0

Maea
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	33,492,916 - 33,530,638 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	33,492,853 - 33,530,640 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	33,335,572 - 33,373,294 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	33,335,509 - 33,373,296 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	33,678,221 - 33,715,943 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	33,652,467 - 33,689,370 (+)	NCBI		MGSCv36	mm8
Celera	5	30,814,826 - 30,852,569 (+)	NCBI		Celera
Cytogenetic Map	5	B1	NCBI
cM Map	5	17.55	NCBI

Maea
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955514	689,868 - 722,779 (+)	Ensembl
ChiLan1.0	NW_004955514	689,867 - 722,779 (+)	NCBI	ChiLan1.0	ChiLan1.0

MAEA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	1,621,007 - 1,673,967 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	1,586,767 - 1,640,160 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	1,432,848 - 1,485,764 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	1,335,508 - 1,366,448 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	1,315,810 - 1,366,448 (+)	Ensembl			panPan2	panpan1.1

MAEA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	62,679,084 - 62,718,154 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	62,682,538 - 62,718,071 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	65,198,239 - 65,234,415 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	63,157,007 - 63,193,190 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	63,154,149 - 63,193,141 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	62,648,983 - 62,685,136 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	62,852,407 - 62,888,598 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	63,211,815 - 63,248,001 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Maea
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	68,257,773 - 68,294,743 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936477	21,959,465 - 21,996,937 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936477	21,959,465 - 21,996,395 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MAEA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	543,291 - 568,452 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	543,281 - 568,437 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

MAEA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	47,425,276 - 47,473,618 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	47,425,185 - 47,473,626 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666051	3,765,578 - 3,816,123 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Maea
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624755	25,934,569 - 25,968,706 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624755	25,934,569 - 25,968,726 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Maea
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	71,477,149 - 71,510,429 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Maea
277 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	133
Count of miRNA genes:	98
Interacting mature miRNAs:	118
Transcripts:	ENSRNOT00000007181
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	38023710	83023710	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	59848686	104848686	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	77914838	104348525	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39009444	84009444	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	72970210	87582095	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30674469	85041098	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	74255551	109089856	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	77640071	96755654	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	38023710	83023710	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	62398852	107398852	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	100078267	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	60854936	105854936	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	74255551	109089856	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	77640071	96755654	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	59848686	104848686	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	38023710	83023710	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42616258	99224555	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	65920283	99224555	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39411170	87582095	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	38023710	83023710	Rat

Markers in Region

BE109850

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	77,365,258 - 77,365,416 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	82,672,250 - 82,672,407	NCBI	Rnor6.0
Rnor_5.0	14	83,358,200 - 83,358,357	UniSTS	Rnor5.0
RGSC_v3.4	14	83,150,011 - 83,150,168	UniSTS	RGSC3.4
Celera	14	76,284,547 - 76,284,704	UniSTS
RH 3.4 Map	14	510.37	UniSTS
Cytogenetic Map	14	q21	UniSTS

UniSTS:235163

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	77,357,498 - 77,357,582 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	82,664,486 - 82,664,569	NCBI	Rnor6.0
Rnor_5.0	14	83,349,802 - 83,349,885	UniSTS	Rnor5.0
RGSC_v3.4	14	83,157,877 - 83,157,960	UniSTS	RGSC3.4
Celera	14	76,276,790 - 76,276,873	UniSTS
Cytogenetic Map	14	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085770	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV109439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007181 ⟹ ENSRNOP00000007181

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	81,581,785 - 81,615,202 (-)	Ensembl
mRatBN7.2 Ensembl	14	77,357,264 - 77,390,671 (-)	Ensembl
Rnor_6.0 Ensembl	14	82,664,249 - 82,697,673 (-)	Ensembl

RefSeq Acc Id:

NM_001008319 ⟹ NP_001008320

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	81,581,784 - 81,615,202 (-)	NCBI
mRatBN7.2	14	77,357,261 - 77,390,683 (-)	NCBI
Rnor_6.0	14	82,664,248 - 82,697,673 (-)	NCBI
Rnor_5.0	14	83,349,564 - 83,383,727 (-)	NCBI
RGSC_v3.4	14	83,124,774 - 83,158,198 (+)	RGD
Celera	14	76,276,552 - 76,309,970 (-)	NCBI

Sequence:

show sequence

CCGTACCCGCCTCCTCCGCTCGGCCGGCCCAAGATGGCGGTGCAGGAGTCGGCGGCCCAGCTGT
CCATGACCCTGAAGGTGCAGGAGTACCCGACCCTCAAGGTGCCCTATGAGACACTGAATAAACG
CTTCCGAGCTGCTCAGAAAAACATTGATCGGGAGACCAGCCACGTCACCATGGTGGTAGCTGAG
CTTGAGAAGACCTTGAGTAGCTGCCCAGCTGTGGACTCTGTGGTCAGCCTACTGGATGGAGTGG
TGGAGAAGCTGAGTGTCCTCAAGAGGAAGGCAGTAGAGTCCATCCAGGCCGAGGATGAGAGCGC
CAAGCTCTGCAAACGTAGGATCGAGCACCTCAAGGAGCACAGCAGTGACCAGCCAGCGGCGGCC
AGCATGTGGAAGCGGAAGCGCATGGACCGAATGATGGTGGAGCACCTGCTGCGCTGTGGCTACT
ACAACACAGCTGTGAAGCTGGCTCGCCAGAGTGGCATTGAGGACCTTGTGAATATCGAGATGTT
CCTGACAGCCAAAGAAGTGGAGGAGTCCTTGGAGAGGCGTGAGACAGCCACCTGCCTTGCCTGG
TGCCATGATAACAAGTCCCGACTCCGGAAGATGAAGAGCTGCTTAGAGTTCAGCCTCAGGATTC
AGGAGTTCATCGAACTTGTCCGGCAGAACAAGCGCCTGGATGCTGTGAGACATGCAAGAAAGCA
CTTCAGTCAGGCTGAAGGGAGCCAACTGGATGAGGTCCGCCAGGTCATGGGCATGCTGGCCTTC
CCACCAGACACACATATCTCTCCATACAAGGACCTCCTGGACCCAGCCCGGTGGCGAATGCTGA
TCCAGCAGTTTCGATATGACAACTACCGGCTGCACCAGCTGGGAAACAGCTCCGTCTTCACCCT
CACCCTGCAGGCTGGGCTCTCAGCAATAAAGACACCACAGTGCTACAAGGAGGATGGCAGCTCC
AAGAGCCCCGACTGCCCTGTGTGCAGCCGCTCTCTGAACAAACTGGCACAGCCCCTACCCATGG
CTCACTGTGCCAACTCCCGCCTGGTCTGCAAGATCTCTGGTGACGTGATGAACGAGAACAACCC
ACCCATGATGCTGCCTAATGGCTATGTCTATGGCTACAATTCTCTGCTTTCTATTCGTCAAGAT
GATAAAGTTGTTTGCCCAAGAACCAAAGAAGTCTTCCACTTCTCCCAAGCTGAGAAAGTGTACA
TCATGTAGGCCTGCGTTGCCATGTGCACGCCCTTGGCCAGAGGCTGTGGTGGGTGGGAGCCATG
CCCTCCTGCCCTGACCCTTGACCCCTGACCCCAGCCTGCCTCGGCATTTGTTTCTTGCGACCAA
AGATCAGTGAGCAACGACAAATACTCTTAGAAAAAGAGGAAGTGAGATTTACTAAGTCTGTGCT
TGAGAACAGCGTTTGGTTGGTAGGATTTTGTAACATAAGTCGACTGATGCCTCTGCAGGTTCTT
GCACCTCTCAAAGGAAACTCTCTCTACAGTGTGGCCTGAGCACCAGGAAATCCAGAGCATCTCA
GAAGTAGGAATTGGGTCATCGATTATTTCCCTGTGTCTCTCCGTTTCCTTCCTTTTGCTAGTGA
TGGGACTCAGGGGAGCTTGAGGAGCAGGCTGGTCCTTTGCCAACTCTTGTTGGTCATAGCCTGG
GCAAGGTGCTGGCCGTACCAGGTTGGCTGCAGTGACTTGTGACGTGGTGCCGAGGCCTTTCCTG
ACTTCACTGTCTAGCTGCTGCCAAAGCACCATCCACCACATGCACCTGGGCTGCTACTCGAGCC
TCTGCCCTTGTGGCCAGGGTGTCTGGGGCTGTGTCTGTGCACAGGTTCAGCGTCTCACCTTCCA
GCACCGCCTTATCTCCTGCTTTGAGAATGTATTCACGGGAAAGCCACTGGACTGAGTTTCTGCA
GAGGCCTTGCCAGGTGGTTCCGTAGTCCTAGAGTGTACATGCTTTTCATTACGGAAACTGATAG
TTCAGCTAAAGTAAGTACTGACGGGTTTTCCAGACATGAACCATTGTAATTCACACAAAACCAT
ATTGTAGAGGTTTGTATCTAGCGCTTATTTTTGCATGTTGATGTTGATTAGCTAATGAACTGTA
AATGTAAAGCGTGTTAATAAAATAGCTTTCTATTTCTCAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

hide sequence

RefSeq Acc Id:

XM_039091798 ⟹ XP_038947726

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	81,581,784 - 81,614,483 (-)	NCBI
mRatBN7.2	14	77,357,261 - 77,389,962 (-)	NCBI

RefSeq Acc Id:

XM_039091799 ⟹ XP_038947727

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	81,581,784 - 81,614,839 (-)	NCBI
mRatBN7.2	14	77,357,261 - 77,390,221 (-)	NCBI

RefSeq Acc Id:

XM_063273013 ⟹ XP_063129083

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	81,581,784 - 81,615,246 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001008320	(Get FASTA)	NCBI Sequence Viewer
	XP_038947726	(Get FASTA)	NCBI Sequence Viewer
	XP_038947727	(Get FASTA)	NCBI Sequence Viewer
	XP_063129083	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85770	(Get FASTA)	NCBI Sequence Viewer
	EDM00130	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007181
GenBank Protein	Q5RKJ1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008320 ⟸ NM_001008319

- UniProtKB:

Q5RKJ1 (UniProtKB/Swiss-Prot), A6IK66 (UniProtKB/TrEMBL), A0A8L2Q2K9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAVQESAAQLSMTLKVQEYPTLKVPYETLNKRFRAAQKNIDRETSHVTMVVAELEKTLSSCPAV
DSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASMWKRKRMDRM
MVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLAWCHDNKSRLRKM
KSCLEFSLRIQEFIELVRQNKRLDAVRHARKHFSQAEGSQLDEVRQVMGMLAFPPDTHISPYKD
LLDPARWRMLIQQFRYDNYRLHQLGNSSVFTLTLQAGLSAIKTPQCYKEDGSSKSPDCPVCSRS
LNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYVYGYNSLLSIRQDDKVVCPRTKEV
FHFSQAEKVYIM

hide sequence

Ensembl Acc Id:

ENSRNOP00000007181 ⟸ ENSRNOT00000007181

RefSeq Acc Id:	XP_038947727 ⟸ XM_039091799
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2Q2K9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038947726 ⟸ XM_039091798
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2Q2K9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063129083 ⟸ XM_063273013
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q2K9 (UniProtKB/TrEMBL)

Protein Domains

CTLH LisH RING-Gid-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5RKJ1-F1-model_v2	AlphaFold	Q5RKJ1	1-396	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699412

Promoter ID:

EPDNEW_R9937

Type:

multiple initiation site

Name:

Maea_1

Description:

macrophage erythroblast attacher

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	82,697,663 - 82,697,723	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309877	AgrOrtholog
BioCyc Gene	G2FUF-15255	BioCyc
Ensembl Genes	ENSRNOG00000005397	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000007181	ENTREZGENE
IMAGE_CLONE	IMAGE:7189726	IMAGE-MGC_LOAD
InterPro	CRA_dom	UniProtKB/Swiss-Prot
	CTLH/CRA	UniProtKB/Swiss-Prot
	CTLH_C	UniProtKB/Swiss-Prot
	Fyv10_fam	UniProtKB/Swiss-Prot
	LisH	UniProtKB/Swiss-Prot
	ZF_RING_GID	UniProtKB/Swiss-Prot
KEGG Report	rno:298982	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93683	IMAGE-MGC_LOAD
NCBI Gene	298982	ENTREZGENE
PANTHER	PTHR12170	UniProtKB/Swiss-Prot
	PTHR12170:SF2	UniProtKB/Swiss-Prot
Pfam	CLTH	UniProtKB/Swiss-Prot
PhenoGen	Maea	PhenoGen
PROSITE	CTLH	UniProtKB/Swiss-Prot
	LISH	UniProtKB/Swiss-Prot
	ZF_RING_GID	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000005397	RatGTEx
SMART	CRA	UniProtKB/Swiss-Prot
	CTLH	UniProtKB/Swiss-Prot
	LisH	UniProtKB/Swiss-Prot
Superfamily-SCOP	RING/U-box	UniProtKB/Swiss-Prot
UniProt	A0A8L2Q2K9	ENTREZGENE, UniProtKB/TrEMBL
	A6IK66	ENTREZGENE, UniProtKB/TrEMBL
	MAEA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-04-28	Maea	macrophage erythroblast attacher, E3 ubiquitin ligase	Maea	macrophage erythroblast attacher	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Maea	macrophage erythroblast attacher	Maea_predicted	macrophage erythroblast attacher (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Maea_predicted	macrophage erythroblast attacher (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD