Advanced Search (OLGA)

Gene: Gatc (glutamyl-tRNA amidotransferase subunit C) Rattus norvegicus

Analyze

Symbol:

Gatc

Name:

glutamyl-tRNA amidotransferase subunit C

RGD ID:

1309698

Description:

Predicted to enable ATP binding activity and glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity. Predicted to be involved in glutaminyl-tRNAGln biosynthesis via transamidation and mitochondrial translation. Predicted to be part of glutamyl-tRNA(Gln) amidotransferase complex. Predicted to be active in mitochondrion. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 42. Orthologous to human GATC (glutamyl-tRNA amidotransferase subunit C); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

gatC-like protein; glu-AdT subunit C; glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial; glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial-like; glutamyl-tRNA(Gln) amidotransferase, subunit C; glutamyl-tRNA(Gln) amidotransferase, subunit C homolog; glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial); LOC100909836; LOC360821; RGD1309698; similar to Putative protein 15E1.2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GATC (glutamyl-tRNA amidotransferase subunit C)	HGNC	EggNOG, Ensembl, HomoloGene, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gatc (glutamyl-tRNA amidotransferase subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gatc (glutamyl-tRNA amidotransferase subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GATC (glutamyl-tRNA amidotransferase subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GATC (glutamyl-tRNA amidotransferase subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gatc (glutamyl-tRNA amidotransferase subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GATC (glutamyl-tRNA amidotransferase subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GATC (glutamyl-tRNA amidotransferase subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gatc (glutamyl-tRNA amidotransferase subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gatc (glutamyl-tRNA amidotransferase subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Gatc (glutamyl-tRNA amidotransferase subunit C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GATC (glutamyl-tRNA amidotransferase subunit C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y66D12A.7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GatC	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gatc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gatc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	46,930,820 - 46,938,790 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	46,930,630 - 46,938,776 (+)	Ensembl				GRCr8
mRatBN7.2	12	41,270,096 - 41,278,067 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,270,087 - 41,277,995 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	42,436,878 - 42,444,864 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	43,050,547 - 43,058,532 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	42,111,100 - 42,119,086 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	12	48,198,523 - 48,206,498 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	12	48,121,822 - 48,129,792 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	12	46,987,610 - 46,995,585 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	12	57,446,230 - 57,454,200 (+)	NCBI		F344_StmMcwi
Rnor_6.0	12	47,031,545 - 47,039,556 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	47,031,595 - 47,036,956 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	12	46,989,951 - 47,039,542 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	48,824,902 - 48,832,872 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	42,538,202 - 42,546,172 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	42,891,045 - 42,899,015 (+)	NCBI		Celera
RGSC_v3.1	12	42,401,598 - 42,649,780 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

combined oxidative phosphorylation deficiency 42 (ISO)

Mitochondrial Cardiomyopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

doxorubicin (ISO)

endosulfan (EXP)

finasteride (EXP)

flutamide (EXP)

FR900359 (ISO)

ivermectin (ISO)

methidathion (ISO)

nitrates (ISO)

paracetamol (EXP,ISO)

rac-lactic acid (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulforaphane (ISO)

tamibarotene (ISO)

tetrachloromethane (EXP)

tributylstannane (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

glutaminyl-tRNAGln biosynthesis via transamidation (IBA,IEA,ISO)

mitochondrial translation (IBA,IEA,ISO)

regulation of translational fidelity (IEA)

translation (IEA)

Cellular Component

glutamyl-tRNA(Gln) amidotransferase complex (IBA,IEA,ISO)

mitochondrion (IBA,IEA,ISO)

Molecular Function

ATP binding (IEA)

carbon-nitrogen ligase activity, with glutamine as amido-N-donor (IEA)

glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity (IEA)

ligase activity (IEA)

nucleotide binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:19805282	PMID:24579914

Genomics

Comparative Map Data

Gatc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	46,930,820 - 46,938,790 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	46,930,630 - 46,938,776 (+)	Ensembl				GRCr8
mRatBN7.2	12	41,270,096 - 41,278,067 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,270,087 - 41,277,995 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	42,436,878 - 42,444,864 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	43,050,547 - 43,058,532 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	42,111,100 - 42,119,086 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	12	48,198,523 - 48,206,498 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	12	48,121,822 - 48,129,792 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	12	46,987,610 - 46,995,585 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	12	57,446,230 - 57,454,200 (+)	NCBI		F344_StmMcwi
Rnor_6.0	12	47,031,545 - 47,039,556 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	47,031,595 - 47,036,956 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	12	46,989,951 - 47,039,542 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	48,824,902 - 48,832,872 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	42,538,202 - 42,546,172 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	42,891,045 - 42,899,015 (+)	NCBI		Celera
RGSC_v3.1	12	42,401,598 - 42,649,780 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

GATC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	120,446,444 - 120,463,749 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	120,446,444 - 120,463,749 (+)	Ensembl			hg38	GRCh38
GRCh37	12	120,884,247 - 120,901,552 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	119,368,667 - 119,382,145 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	120,518,953 - 120,536,271 (+)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	117,893,031 - 117,910,347 (+)	NCBI		HuRef
CHM1_1	12	120,852,732 - 120,870,048 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	120,434,957 - 120,452,263 (+)	NCBI		T2T-CHM13v2.0

Gatc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	115,471,301 - 115,479,220 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	115,471,298 - 115,479,237 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	115,333,242 - 115,341,161 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	115,333,239 - 115,341,178 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	115,783,251 - 115,791,170 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	115,594,241 - 115,602,160 (-)	NCBI		MGSCv36	mm8
Celera	5	112,430,278 - 112,438,417 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	56.05	NCBI

Gatc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	11,184,693 - 11,195,340 (-)	Ensembl
ChiLan1.0	NW_004955455	11,184,400 - 11,195,398 (-)	NCBI	ChiLan1.0	ChiLan1.0

GATC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	128,514,711 - 128,532,091 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	128,511,088 - 128,528,472 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	118,028,042 - 118,045,403 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	121,402,534 - 121,419,638 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	121,402,532 - 121,419,628 (+)	Ensembl			panPan2	panpan1.1

GATC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	16,352,826 - 16,362,298 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	16,356,405 - 16,366,776 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	16,619,962 - 16,630,331 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	16,620,025 - 16,630,672 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	16,580,028 - 16,590,399 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	16,656,738 - 16,667,109 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	16,698,571 - 16,708,944 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gatc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	145,993,682 - 146,001,964 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936668	488,026 - 500,800 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936668	492,571 - 500,845 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GATC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	40,414,017 - 40,423,628 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	40,413,864 - 40,425,306 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	42,881,364 - 42,890,910 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GATC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	115,800,928 - 115,813,142 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	115,800,949 - 115,812,555 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	129,286,253 - 129,299,236 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gatc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	13,210,282 - 13,220,328 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	13,210,001 - 13,220,434 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gatc
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	38,481,590 - 38,488,417 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	471
Count of miRNA genes:	242
Interacting mature miRNAs:	287
Transcripts:	ENSRNOT00000001536, ENSRNOT00000070868
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	44139558	52308831	Rat

Markers in Region

BI286497

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	41,277,507 - 41,277,727 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	47,038,998 - 47,039,217	NCBI	Rnor6.0
Rnor_5.0	12	48,832,314 - 48,832,533	UniSTS	Rnor5.0
RGSC_v3.4	12	42,545,614 - 42,545,833	UniSTS	RGSC3.4
Celera	12	42,898,457 - 42,898,676	UniSTS
RH 3.4 Map	12	774.92	UniSTS
Cytogenetic Map	12	q16	UniSTS

RH141055

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	41,278,246 - 41,278,445 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	47,039,736 - 47,039,934	NCBI	Rnor6.0
Rnor_5.0	12	48,833,052 - 48,833,250	UniSTS	Rnor5.0
RGSC_v3.4	12	42,546,352 - 42,546,550	UniSTS	RGSC3.4
Celera	12	42,899,195 - 42,899,393	UniSTS
Cytogenetic Map	12	q16	UniSTS

RH140294

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	41,276,595 - 41,276,796 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	47,038,086 - 47,038,286	NCBI	Rnor6.0
Rnor_5.0	12	48,831,402 - 48,831,602	UniSTS	Rnor5.0
RGSC_v3.4	12	42,544,702 - 42,544,902	UniSTS	RGSC3.4
Celera	12	42,897,545 - 42,897,745	UniSTS
RH 3.4 Map	12	771.92	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
24	18	88	246	148	146	84	117	84	12	478	261	11	205	98	136	62	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001536 ⟹ ENSRNOP00000001536

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	46,989,951 - 47,039,542 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000070868 ⟹ ENSRNOP00000063917

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	46,930,818 - 46,938,776 (+)	Ensembl
mRatBN7.2 Ensembl	12	41,270,087 - 41,277,995 (+)	Ensembl
Rnor_6.0 Ensembl	12	47,031,595 - 47,036,956 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000148228 ⟹ ENSRNOP00000110710

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	46,930,630 - 46,935,108 (+)	Ensembl

RefSeq Acc Id:

NM_001108339 ⟹ NP_001101809

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,930,820 - 46,938,790 (+)	NCBI
mRatBN7.2	12	41,270,096 - 41,278,067 (+)	NCBI
Dahl_SR_JrHsd	12	48,198,523 - 48,206,498 (+)	NCBI
Lyon_Normotensive	12	48,121,822 - 48,129,792 (+)	NCBI
Lyon_Hypertensive	12	46,987,610 - 46,995,585 (+)	NCBI
F344_StmMcwi	12	57,446,230 - 57,454,200 (+)	NCBI
Rnor_6.0	12	47,031,586 - 47,039,556 (+)	NCBI
Rnor_5.0	12	48,824,902 - 48,832,872 (+)	NCBI
RGSC_v3.4	12	42,538,202 - 42,546,172 (+)	RGD
Celera	12	42,891,045 - 42,899,015 (+)	RGD

Sequence:

show sequence

GAAGCAAAGATGTGGGCACAGGCGGCGAGGGTGCAATTTCGGGCTCCTCTGGACCGGGGCCGAA
GTTTTGCTTCCAAAGTGGGTCCACGCGGAAAGGTCCAGGCGGCGGACCCGAAGACCCAGGCTCC
ACGCCTAGTCCCGGAGGGCACCGATCGCGTGTCCGCCGCGGTAGTCGAGCATCTGGAGCGGCTG
GCACTGGTGAACTTCAGCAGCCGCGAGGCGGTGGACCGGCTAGAGAAAGCCGTGGCCTTTGCCG
ACCAGCTGCACGCCGTGGACACCGACGGGGTGGAGCCCCTGGAGTCGGTTCTGGAGGACAGATG
TCTCTACCTGAGATCTGACAAGGTAGCCGAAGGCGGCTGTGCAGAAGAACTACTACAGAACTCA
AATCACGTTGTGGAGGAGTACTTTGTGGCCCCCCCAGGTAATATTCCTTTGCCAGACATGGTGG
GCAAGGTCCCTTCTTCCACAGCAGAGTAGCTGTTCTGGGAGGGGTACCCTGTCAACATGGTGGA
CTCACATGGGTGGCCATCTGCTACTGTGAATTCTAGCATAATGGACATTTACCACTTCCCCGTA
ATTGATCTGAAGACAAGAGCTAGAAAACTCAGCTAACGGAAAACTACAAGCCCCCTTCGTGGAT
GTGGATCAAATGCTCAGGCCTGTTCTGTATGGAAAACATCTTCCTCCTTTGTCTGCCCCTAAAA
ACACTACCTTGTCAAAACGTATCCATGTGGACTTTTCTGTTTACATGTAAGACACAGATGACCT
GTGTTGCTTTTCCACCACCCCGTGGAGAGCCAGCCCATCACCATCTGTTTCTGGGTACCCACCC
ACCTTATTCCTACATAGGGCTTGTTTTATGGCTAGATTTGAGTAATATCAAAGTAAACTACAGC
GTGGGATCTCCTCATTCAGAATCATCTTTCTTTCTCAGAAAGCTATCCAATCCCCACTTCACAC
TCAGTGTCCATGAACAGAGACCCTCTCACACACTGTGTACGTGAACACCGGACACCACCCCACC
CCCACCCCCATACACCATGCATATGAACACCAGCCACATAGTTCCTTTCTGAAAAGAGATCTTG
TAAAACCAGCCCTGGGCCAGTTTTCATCCTTCTCTTTCCTTTATCTGCAAGGTCTGTGTCCCCC
ACCCCCTTGTTCAGATAGGGCCTCTGCACACATCAGGCTGGCCTTGAGCACACTATCTCCCTGC
TGCAGCCTCCCAGCACAGGGATGGGAGGCATGAACCCCTCAGTGAACTAGTGCAAGCAGTTTCC
TTTACAGCCTCAGTTCTGCATTGGAAGAACTCCACATCTGGATTAGAGATCCCTCAGTGACTGA
GAACTTCTAACCCAGGTGTGGTGGCTCCCGTCTTTAATCCCAGCACTTGGGAGGCAGAGGCAAA
CAGAGCCCTGAGTTCAAGTTCAGTCTGGTTTACAAAGCCAGAATTATTCTAAGAAACCCTCTCT
GGAAAAGAAAAAAGCAGAAAAACAAATAAATAAAAGCCCAGAATTTCCTGATCTTCGGTCTGAG
CTGAGTCAGGCTCTGACCGCCTAGAATTCCAGCTCTGCAGAGGCTGATGCTGTCTTTCTGGTCT
CTGAGGCACTAACACACATGCGGCATAAACATGTGAATAAAAACCAATCTTAAAAAGAGTCTGG
GGGTTGGGGATTTAGCTCAGTGGTAGAGCGCTTGCCTAGCAAGCACAAGGCCCTGGGTTCGGTC
CCCAGCTCCAAAGAAAAAGAAAAAAAAAAAAAAAAAAAAGAGTCTGCCTGGGCTGGAGGGATGG
CTCAGTGGTTAAGAGCACCCGACTGCTCTTCCAGAGGTCATGAGTTCAATTCCCAGCAACCACA
TGGTGGCTCACAACCATCTGTAAGGAGATCTGATGCCCTCTTCTGGTGTCTGAAGACAGCTACA
GTATACTCATATATAATAAATGAATAAATCTTTAAAAAAAAAGAGTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101809	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3ZY68	(Get FASTA)	NCBI Sequence Viewer
	EDM13888	(Get FASTA)	NCBI Sequence Viewer
	EDM13889	(Get FASTA)	NCBI Sequence Viewer
	EDM13890	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063917
	ENSRNOP00000063917.3

RefSeq Acc Id:	NP_001101809 ⟸ NM_001108339
- UniProtKB:	D3ZY68 (UniProtKB/Swiss-Prot), M0R3K2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MWAQAARVQFRAPLDRGRSFASKVGPRGKVQAADPKTQAPRLVPEGTDRVSAAVVEHLERLALV NFSSREAVDRLEKAVAFADQLHAVDTDGVEPLESVLEDRCLYLRSDKVAEGGCAEELLQNSNHV VEEYFVAPPGNIPLPDMVGKVPSSTAE hide sequence

Ensembl Acc Id:

ENSRNOP00000063917 ⟸ ENSRNOT00000070868

Ensembl Acc Id:

ENSRNOP00000001536 ⟸ ENSRNOT00000001536

Ensembl Acc Id:

ENSRNOP00000110710 ⟸ ENSRNOT00000148228

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZY68-F1-model_v2	AlphaFold	D3ZY68	1-155	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698698

Promoter ID:

EPDNEW_R9218

Type:

multiple initiation site

Name:

Gatc_1

Description:

glutamyl-tRNA amidotransferase subunit C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	47,031,587 - 47,031,647	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309698	AgrOrtholog
BioCyc Gene	G2FUF-18986	BioCyc
BioCyc Pathway	CITRULBIO-PWY [L-citrulline biosynthesis]	BioCyc
	GLUTAMINDEG-PWY [L-glutamine degradation I]	BioCyc
	PWY-5921 [glutaminyl-tRNAgln biosynthesis via transamidation]	BioCyc
BioCyc Pathway Image	CITRULBIO-PWY	BioCyc
	GLUTAMINDEG-PWY	BioCyc
	PWY-5921	BioCyc
Ensembl Genes	ENSRNOG00000001161	Ensembl
	ENSRNOG00000045621	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000070868	ENTREZGENE
	ENSRNOT00000070868.3	UniProtKB/Swiss-Prot
InterPro	Asp/Glu-ADT_csu	UniProtKB/Swiss-Prot
	Asp/Glu-ADT_sf_sub_c	UniProtKB/Swiss-Prot
KEGG Report	rno:360821	UniProtKB/Swiss-Prot
NCBI Gene	360821	ENTREZGENE
PANTHER	GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT C, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR15004	UniProtKB/Swiss-Prot
Pfam	Glu-tRNAGln	UniProtKB/Swiss-Prot
PhenoGen	Gatc	PhenoGen
RatGTEx	ENSRNOG00000001161	RatGTEx
	ENSRNOG00000045621	RatGTEx
Superfamily-SCOP	SSF141000	UniProtKB/Swiss-Prot
UniProt	A0ABK0LZE2_RAT	UniProtKB/TrEMBL
	D3ZY68	ENTREZGENE, UniProtKB/Swiss-Prot
	M0R3K2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Gatc	glutamyl-tRNA amidotransferase subunit C	LOC100909836	glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial-like	Data merged from RGD:6501760	737654	PROVISIONAL
2016-06-29	Gatc	glutamyl-tRNA amidotransferase subunit C	Gatc	glutamyl-tRNA(Gln) amidotransferase, subunit C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-11-07	Gatc	glutamyl-tRNA(Gln) amidotransferase, subunit C	Gatc	glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100909836	glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-05-02	Gatc	glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)	RGD1309698	similar to Putative protein 15E1.2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1309698	similar to Putative protein 15E1.2	RGD1309698_predicted	similar to Putative protein 15E1.2 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1309698_predicted	similar to Putative protein 15E1.2 (predicted)	LOC360821_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC360821_predicted	similar to Putative protein 15E1.2 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

BioCyc Pathways