Advanced Search (OLGA)

Gene: Cmss1 (cms1 ribosomal small subunit homolog) Rattus norvegicus

Analyze

Symbol:

Cmss1

Name:

cms1 ribosomal small subunit homolog

RGD ID:

1309437

Description:

Orthologous to human CMSS1 (cms1 ribosomal small subunit homolog); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cms1 ribosomal small subunit homolog (yeast); hypothetical protein LOC288176; LOC288176; MGC108788; RGD1309437; similar to RIKEN cDNA 2610528E23; uncharacterized protein C3orf26 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CMSS1 (cms1 ribosomal small subunit homolog)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cmss1 (cms small ribosomal subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cmss1 (cms1 ribosomal small subunit homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CMSS1 (cms1 ribosomal small subunit homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CMSS1 (cms1 ribosomal small subunit homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cmss1 (cms1 ribosomal small subunit homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CMSS1 (cms1 ribosomal small subunit homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CMSS1 (cms1 ribosomal small subunit homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cmss1 (cms1 ribosomal small subunit homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cmss1 (cms1 ribosomal small subunit homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Cmss1 (cms small ribosomal subunit 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CMSS1 (cms1 ribosomal small subunit homolog)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cmss1 (cms1 ribosomal small subunit homolog)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CMS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	cmss1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	cmss1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	56,403,620 - 56,701,751 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	56,403,499 - 56,701,755 (+)	Ensembl				GRCr8
mRatBN7.2	11	42,934,390 - 43,232,624 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	42,934,440 - 43,232,624 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	51,691,140 - 51,988,856 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	44,352,719 - 44,650,457 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	43,481,315 - 43,779,056 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	45,031,627 - 45,330,481 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	45,304,068 - 45,330,481 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	48,227,651 - 48,526,022 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	43,763,988 - 44,068,609 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	42,729,243 - 43,026,886 (+)	NCBI		Celera
RGSC_v3.1	11	43,821,576 - 44,126,198 (+)	NCBI
Cytogenetic Map	11	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-phenylbutyric acid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amosite asbestos (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cantharidin (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (EXP,ISO)

clobetasol (ISO)

clofibrate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

deguelin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

diethylstilbestrol (ISO)

doxorubicin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

hydrogen peroxide (EXP)

indometacin (ISO)

ivermectin (ISO)

methyl methanesulfonate (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

serpentine asbestos (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

testosterone (ISO)

topotecan (EXP)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:22658674	PMID:22681889

Genomics

Comparative Map Data

Cmss1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	56,403,620 - 56,701,751 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	56,403,499 - 56,701,755 (+)	Ensembl				GRCr8
mRatBN7.2	11	42,934,390 - 43,232,624 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	42,934,440 - 43,232,624 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	51,691,140 - 51,988,856 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	44,352,719 - 44,650,457 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	43,481,315 - 43,779,056 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	45,031,627 - 45,330,481 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	45,304,068 - 45,330,481 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	48,227,651 - 48,526,022 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	43,763,988 - 44,068,609 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	42,729,243 - 43,026,886 (+)	NCBI		Celera
RGSC_v3.1	11	43,821,576 - 44,126,198 (+)	NCBI
Cytogenetic Map	11	q12	NCBI

CMSS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	99,817,862 - 100,181,732 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	99,817,837 - 100,181,732 (+)	Ensembl			hg38	GRCh38
GRCh37	3	99,536,706 - 99,900,576 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	101,019,371 - 101,380,137 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	3	97,925,790 - 98,288,081 (+)	NCBI		Celera
Cytogenetic Map	3	q12.1	NCBI
HuRef	3	96,904,913 - 97,265,639 (+)	NCBI		HuRef
CHM1_1	3	99,499,704 - 99,860,531 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	102,522,903 - 102,887,068 (+)	NCBI		T2T-CHM13v2.0

Cmss1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	57,122,362 - 57,427,230 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	57,122,363 - 57,427,227 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	57,301,999 - 57,606,867 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	57,302,000 - 57,606,864 (-)	Ensembl			mm10	GRCm38
MGSCv37	16	57,302,113 - 57,606,980 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	57,223,358 - 57,527,989 (-)	NCBI		MGSCv36	mm8
Celera	16	57,628,292 - 57,931,867 (-)	NCBI		Celera
Cytogenetic Map	16	C1.1	NCBI
cM Map	16	34.22	NCBI

Cmss1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	1,712,144 - 1,735,550 (+)	Ensembl
ChiLan1.0	NW_004955427	1,668,471 - 1,734,494 (+)	NCBI	ChiLan1.0	ChiLan1.0

CMSS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	97,763,434 - 98,123,856 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	97,768,320 - 98,128,639 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	96,911,423 - 97,271,711 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	103,594,246 - 103,954,435 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	103,917,730 - 103,954,435 (+)	Ensembl			panPan2	panpan1.1

CMSS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	6,442,721 - 6,818,394 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	6,443,035 - 6,818,171 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	6,442,013 - 6,973,961 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	6,424,979 - 6,956,940 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	6,425,053 - 6,566,276 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
ROS_Cfam_1.0 Ensembl	33	6,582,244 - 6,956,717 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	6,310,047 - 6,845,079 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	6,360,807 - 6,892,880 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	6,844,108 - 7,222,833 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0
UU_Cfam_GSD_1.0	33	6,644,494 - 6,786,927 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cmss1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	150,212,734 - 150,531,849 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936630	3,110,843 - 3,429,608 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936630	3,109,765 - 3,429,717 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CMSS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	158,800,142 - 159,192,107 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	158,798,780 - 159,192,153 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	168,488,979 - 168,533,672 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CMSS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	80,703,785 - 81,075,083 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	80,703,774 - 80,736,647 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	85,501,176 - 85,871,318 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cmss1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624789	13,535,965 - 13,567,131 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624789	13,160,508 - 13,567,354 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cmss1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	41,403,301 - 41,429,529 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cmss1
1390 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	22
Count of miRNA genes:	22
Interacting mature miRNAs:	22
Transcripts:	ENSRNOT00000031464
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
1598841	Memor7	Memory QTL 7			exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	11	33306008	78306008	Rat
1598811	Bp291	Blood pressure QTL 291	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	33306008	78306008	Rat
11528648	Bss118	Bone structure and strength QTL 118	6.658	2e-07	femur strength trait (VT:0010010)	femur ultimate displacement (CMO:0002719)	11	54107987	56845449	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	29958996	57754989	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	31915469	76915469	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	36428416	81428416	Rat
1600394	Edcs1	Endometrial carcinoma susceptibility QTL1	2.9	0.04	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	11	12823152	57823152	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	34618760	79618760	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	36749459	81749459	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	36749459	81749459	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat
631510	Spl2	Serum phospholipid level QTL 2	4.1		blood phospholipid amount (VT:0006084)	serum phospholipid level (CMO:0001171)	11	27556685	72556685	Rat

Markers in Region

D11Got38

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	42,978,140 - 42,978,390 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,075,378 - 45,075,627	NCBI	Rnor6.0
Rnor_5.0	11	48,271,341 - 48,271,590	UniSTS	Rnor5.0
RH 3.4 Map	11	325.9	RGD
RH 3.4 Map	11	325.9	UniSTS
RH 2.0 Map	11	290.5	RGD
Cytogenetic Map	11	q12	UniSTS

D11Got41

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	43,150,411 - 43,150,624 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,597,574 - 45,597,786	NCBI	Rnor6.0
Rnor_6.0	11	45,248,275 - 45,248,487	NCBI	Rnor6.0
Rnor_5.0	11	48,443,978 - 48,444,190	UniSTS	Rnor5.0
Rnor_5.0	11	48,786,968 - 48,787,180	UniSTS	Rnor5.0
RGSC_v3.4	11	43,984,975 - 43,985,187	RGD	RGSC3.4
RGSC_v3.4	11	43,984,975 - 43,985,187	UniSTS	RGSC3.4
Celera	11	42,944,755 - 42,944,967	UniSTS
RGSC_v3.1	11	44,042,564 - 44,042,776	RGD
RH 3.4 Map	11	319.2	UniSTS
RH 3.4 Map	11	319.2	RGD
RH 2.0 Map	11	306.8	RGD
Cytogenetic Map	11	q12	UniSTS

D11Uwm2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	42,978,119 - 42,978,261 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,075,357 - 45,075,498	NCBI	Rnor6.0
Rnor_5.0	11	48,271,320 - 48,271,461	UniSTS	Rnor5.0
Cytogenetic Map	11	q12	UniSTS

RH129929

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	43,232,361 - 43,232,562 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,330,219 - 45,330,419	NCBI	Rnor6.0
Rnor_5.0	11	48,525,760 - 48,525,960	UniSTS	Rnor5.0
RGSC_v3.4	11	44,068,347 - 44,068,547	UniSTS	RGSC3.4
Celera	11	43,026,624 - 43,026,824	UniSTS
RH 3.4 Map	11	322.6	UniSTS
Cytogenetic Map	11	q12	UniSTS

BF389142

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	42,938,440 - 42,938,623 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,035,667 - 45,035,849	NCBI	Rnor6.0
Rnor_5.0	11	48,231,715 - 48,231,897	UniSTS	Rnor5.0
RGSC_v3.4	11	43,767,962 - 43,768,145	UniSTS	RGSC3.4
Celera	11	42,733,213 - 42,733,395	UniSTS
RH 3.4 Map	11	323.7	UniSTS
Cytogenetic Map	11	q12	UniSTS

BE110684

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	43,092,519 - 43,092,616 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,190,571 - 45,190,667	NCBI	Rnor6.0
Rnor_5.0	11	48,386,274 - 48,386,370	UniSTS	Rnor5.0
RGSC_v3.4	11	43,926,947 - 43,927,043	UniSTS	RGSC3.4
Celera	11	42,886,985 - 42,887,081	UniSTS
RH 3.4 Map	11	320.8	UniSTS
Cytogenetic Map	11	q12	UniSTS

BI293688

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	42,994,151 - 42,994,336 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,091,379 - 45,091,563	NCBI	Rnor6.0
Rnor_5.0	11	48,287,082 - 48,287,266	UniSTS	Rnor5.0
RGSC_v3.4	11	43,827,085 - 43,827,269	UniSTS	RGSC3.4
Celera	11	42,788,776 - 42,788,960	UniSTS
RH 3.4 Map	11	330.8	UniSTS
Cytogenetic Map	11	q12	UniSTS

AI175437

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	42,937,379 - 42,937,499 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,034,606 - 45,034,725	NCBI	Rnor6.0
Rnor_5.0	11	48,230,654 - 48,230,773	UniSTS	Rnor5.0
RGSC_v3.4	11	43,766,897 - 43,767,016	UniSTS	RGSC3.4
Celera	11	42,732,152 - 42,732,271	UniSTS
RH 3.4 Map	11	324.5	UniSTS
Cytogenetic Map	11	q12	UniSTS

fj02a09.x1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	43,212,826 - 43,213,450 (+)	MAPPER	mRatBN7.2
mRatBN7.2	11	43,212,846 - 43,213,450 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	45,310,703 - 45,311,306	NCBI	Rnor6.0
Rnor_6.0	11	45,310,683 - 45,311,306	NCBI	Rnor6.0
Rnor_5.0	11	48,506,244 - 48,506,847	UniSTS	Rnor5.0
Rnor_5.0	11	48,506,224 - 48,506,847	UniSTS	Rnor5.0
RGSC_v3.4	11	44,048,811 - 44,049,434	UniSTS	RGSC3.4
RGSC_v3.4	11	44,048,831 - 44,049,434	UniSTS	RGSC3.4
Celera	11	43,007,111 - 43,007,714	UniSTS
Celera	11	43,007,091 - 43,007,714	UniSTS
Cytogenetic Map	11	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	91	59	6	355	191	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013866	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031464 ⟹ ENSRNOP00000031451

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	56,675,343 - 56,701,737 (+)	Ensembl
mRatBN7.2 Ensembl	11	43,205,402 - 43,232,624 (+)	Ensembl
Rnor_6.0 Ensembl	11	45,304,068 - 45,330,481 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106111 ⟹ ENSRNOP00000094701

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	56,403,499 - 56,701,755 (+)	Ensembl
mRatBN7.2 Ensembl	11	42,934,440 - 43,232,624 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106324 ⟹ ENSRNOP00000097253

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	56,403,515 - 56,701,755 (+)	Ensembl
mRatBN7.2 Ensembl	11	42,994,424 - 43,232,606 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109440 ⟹ ENSRNOP00000077303

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	56,580,766 - 56,701,755 (+)	Ensembl
mRatBN7.2 Ensembl	11	43,111,614 - 43,232,624 (+)	Ensembl

RefSeq Acc Id:

NM_001013866 ⟹ NP_001013888

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	56,403,620 - 56,701,751 (+)	NCBI
mRatBN7.2	11	42,934,471 - 43,232,624 (+)	NCBI
Rnor_6.0	11	45,031,697 - 45,330,481 (+)	NCBI
Rnor_5.0	11	48,227,651 - 48,526,022 (+)	NCBI
RGSC_v3.4	11	43,763,988 - 44,068,609 (+)	RGD
Celera	11	42,729,243 - 43,026,886 (+)	RGD

Sequence:

show sequence

GAAGACCGCGTTCCTTGGTTTTTCCTCGTGCAGCGTTGCTAACGCGGACTCTGAAGCTGATCCC
AGCGGTGCAGCGGGCCGCTTTGCATTCATCTGGTTGTCAGCTCGCGTCCGGGTCTCACGGAGAT
GGCAGACGATCTGGGAGACGAGTGGTGGGAGAACCAGCCGGCCACGGCCGGCAGCCCAGAGCTG
TCAGGTGGAGAGGAAGGAGGAGACACGGAAATGACACAGAAGGACACAGTTCCGGTTCCTGAGA
AAACCAAACAGCCCACTGAGTGTTTCCTGTCACAGGTGAAGGAACCAAAAACAGAGGACTCCCG
GAAGAGCAGGAAGTGGAAGAAGAAGAAAATTTCTGATATTCTTGCAAAATCAGAGCCCAAACCA
GGGACCCCTGAAGACCTTCAGAAGCTGATCAAGGGCCATTACAGCAGCAGCCGTTCTGTGATTG
AATTAGAGGAACTGCACCTACCAGACTCCTGCTTCCTCAAGTGCAATGACTTGACTCACAGTCT
CTCTTCATACCTAAAAGAAATCTGCCCTAAGTGGGTAAAACTTCGGAAAACCCACAATGAGAAA
AAGTCGGTCCTGATGCTGATCCTGTGCAGCTCCGCTGTCCGGGCCCTGGAGCTTATCAGGTCTC
TGACAGCATTCAAAGGAGATGCCAAAGTTATGAAATTATTTGCAAAACACATAAAGGTCCAGGA
GCAGGTGAAGTTGCTGGAGAAGCGAGCGATACACCTGGGCGTGGGGACTCCAGGGAGAATCAAA
GAACTTGTCAAACAAGATGGCCTTAATTTGAACCCCTTAAAGTTTCTGGTTTTTGACTGGAACT
GGAGAGATCAGAAGCTGAGGAGAATGATGGACATTCCCGAGATAAGAAAGGAGGTTTTTGAGCT
TCTAGATATGGGAGTGTTCAGCCTATGCAAATCGGACTCCTTGAAGCTGGGCCTTTTCTGAGCC
AGGGTCCTGATGGAGAGTCCAGTTGCCGACATATTGCAAATACTCAGAATATCCTACTCTGTCG
TAGTTATGTTAACTTCATCGCCCAGTGGATCACTGAAGATGCTTCATGAGGATGCTTTGACAAC
TGTGGGCCTGTCCTTTGGCTCGTACCCTCAGATAATAAAGCTCTGCCTGTGTATGTTGTCTTGT
TAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063270410 ⟹ XP_063126480

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	56,403,739 - 56,701,739 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013888	(Get FASTA)	NCBI Sequence Viewer
	XP_063126480	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89826	(Get FASTA)	NCBI Sequence Viewer
	EDM11027	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000031451
	ENSRNOP00000094701
	ENSRNOP00000094701.1
GenBank Protein	Q5FVR6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013888 ⟸ NM_001013866

- UniProtKB:

Q5FVR6 (UniProtKB/Swiss-Prot), A6IQM4 (UniProtKB/TrEMBL), A0A0H2UHT9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MADDLGDEWWENQPATAGSPELSGGEEGGDTEMTQKDTVPVPEKTKQPTECFLSQVKEPKTEDS
RKSRKWKKKKISDILAKSEPKPGTPEDLQKLIKGHYSSSRSVIELEELHLPDSCFLKCNDLTHS
LSSYLKEICPKWVKLRKTHNEKKSVLMLILCSSAVRALELIRSLTAFKGDAKVMKLFAKHIKVQ
EQVKLLEKRAIHLGVGTPGRIKELVKQDGLNLNPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFE
LLDMGVFSLCKSDSLKLGLF

hide sequence

Ensembl Acc Id:

ENSRNOP00000031451 ⟸ ENSRNOT00000031464

Ensembl Acc Id:

ENSRNOP00000097253 ⟸ ENSRNOT00000106324

Ensembl Acc Id:

ENSRNOP00000094701 ⟸ ENSRNOT00000106111

Ensembl Acc Id:

ENSRNOP00000077303 ⟸ ENSRNOT00000109440

RefSeq Acc Id:	XP_063126480 ⟸ XM_063270410
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6ANA9 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5FVR6-F1-model_v2	AlphaFold	Q5FVR6	1-276	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309437	AgrOrtholog
BioCyc Gene	G2FUF-21546	BioCyc
Ensembl Genes	ENSRNOG00000027888	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000031464	ENTREZGENE
	ENSRNOT00000106111	ENTREZGENE
	ENSRNOT00000106111.1	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7321402	IMAGE-MGC_LOAD
InterPro	Cms1	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:288176	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108788	IMAGE-MGC_LOAD
NCBI Gene	288176	ENTREZGENE
PANTHER	PROTEIN CMSS1	UniProtKB/Swiss-Prot
	PTHR24030	UniProtKB/Swiss-Prot
Pfam	CMS1	UniProtKB/Swiss-Prot
PhenoGen	Cmss1	PhenoGen
RatGTEx	ENSRNOG00000027888	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHT9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y650_RAT	UniProtKB/TrEMBL
	A0A8I6ANA9	ENTREZGENE, UniProtKB/TrEMBL
	A6IQM4	ENTREZGENE, UniProtKB/TrEMBL
	CMS1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-08-15	Cmss1	cms1 ribosomal small subunit homolog	Cmss1	cms1 ribosomal small subunit homolog (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-10	Cmss1	cms1 ribosomal small subunit homolog (yeast)	RGD1309437	similar to RIKEN cDNA 2610528E23	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1309437	similar to RIKEN cDNA 2610528E23	RGD1309437_predicted	similar to RIKEN cDNA 2610528E23 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1309437_predicted	similar to RIKEN cDNA 2610528E23 (predicted)	LOC288176_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC288176_predicted	similar to RIKEN cDNA 2610528E23 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message