Advanced Search (OLGA)

Gene: Drc3 (dynein regulatory complex subunit 3) Rattus norvegicus

Analyze

Symbol:

Drc3

Name:

dynein regulatory complex subunit 3

RGD ID:

1309150

Description:

Predicted to be located in axoneme and sperm flagellum. Predicted to be active in cilium. Orthologous to human DRC3 (dynein regulatory complex subunit 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

leucine rich repeat containing 48; leucine-rich repeat-containing protein 48; LOC287371; LOC691364; Lrrc48; RGD1309150; similar to glyceraldehyde-3-phosphate dehydrogenase, spermatogenic; similar to RIKEN cDNA 4930449E07

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DRC3 (dynein regulatory complex subunit 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Drc3 (dynein regulatory complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DRC3 (dynein regulatory complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DRC3 (dynein regulatory complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Drc3 (dynein regulatory complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DRC3 (dynein regulatory complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DRC3 (dynein regulatory complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Drc3 (dynein regulatory complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Drc3 (dynein regulatory complex subunit 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DRC3 (dynein regulatory complex subunit 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	drc3 (dynein regulatory complex subunit 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ppr-Y	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TbCMF46	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TbCMF46	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	drc3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	45,620,045 - 45,698,902 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	45,648,410 - 45,698,900 (+)	Ensembl				GRCr8
mRatBN7.2	10	45,149,094 - 45,200,659 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	45,157,354 - 45,199,369 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	49,859,561 - 49,899,746 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	49,349,935 - 49,390,124 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	44,853,532 - 44,893,727 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	46,712,021 - 46,762,276 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	46,722,109 - 46,762,250 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	46,466,517 - 46,517,603 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	46,614,082 - 46,662,673 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	44,416,605 - 44,456,596 (+)	NCBI		Celera
RGSC_v3.1	10	46,627,704 - 46,676,287 (+)	NCBI
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

Aflatoxin B2 alpha (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

dibutyl phthalate (EXP)

endosulfan (EXP)

fenvalerate (EXP)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

leflunomide (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

sunitinib (ISO)

titanium dioxide (ISO)

trametinib (ISO)

trichloroethene (EXP)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

axonemal doublet microtubule (ISO)

axoneme (IEA,ISO)

cilium (IBA,IEA)

cytoplasm (ISO)

motile cilium (IEA)

sperm flagellum (ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:26387594

Genomics

Comparative Map Data

Drc3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	45,620,045 - 45,698,902 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	45,648,410 - 45,698,900 (+)	Ensembl				GRCr8
mRatBN7.2	10	45,149,094 - 45,200,659 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	45,157,354 - 45,199,369 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	49,859,561 - 49,899,746 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	49,349,935 - 49,390,124 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	44,853,532 - 44,893,727 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	46,712,021 - 46,762,276 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	46,722,109 - 46,762,250 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	46,466,517 - 46,517,603 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	46,614,082 - 46,662,673 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	44,416,605 - 44,456,596 (+)	NCBI		Celera
RGSC_v3.1	10	46,627,704 - 46,676,287 (+)	NCBI
Cytogenetic Map	10	q22	NCBI

DRC3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	17,972,813 - 18,016,889 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	17,972,813 - 18,016,889 (+)	Ensembl			hg38	GRCh38
GRCh37	17	17,876,127 - 17,920,203 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	17,816,924 - 17,860,898 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	17	18,816,897 - 18,861,264 (+)	NCBI		Celera
Cytogenetic Map	17	p11.2	NCBI
HuRef	17	17,629,874 - 17,673,986 (+)	NCBI		HuRef
CHM1_1	17	17,884,945 - 17,929,004 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	17,919,490 - 17,963,683 (+)	NCBI		T2T-CHM13v2.0

Drc3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	60,243,063 - 60,285,168 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	60,244,155 - 60,285,167 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	60,352,881 - 60,394,342 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	60,353,329 - 60,394,341 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	60,166,882 - 60,207,835 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	60,903,173 - 60,932,554 (+)	NCBI		MGSCv36	mm8
MGSCv36	11	60,169,575 - 60,210,528 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	11	B2	NCBI
cM Map	11	37.81	NCBI

DRC3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	52,487,501 - 52,533,360 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	57,204,737 - 57,246,856 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	33,278,528 - 33,324,351 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	38,226,287 - 38,272,013 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	38,226,305 - 38,272,013 (-)	Ensembl			panPan2	panpan1.1

DRC3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	41,499,810 - 41,534,641 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	41,499,815 - 41,534,549 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	41,638,860 - 41,673,691 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	41,606,191 - 41,641,024 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	41,606,196 - 41,640,929 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	41,573,922 - 41,608,742 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	41,521,329 - 41,556,151 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	41,713,217 - 41,748,048 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Drc3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	61,272,175 - 61,311,357 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936741	1,555,941 - 1,594,898 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936741	1,555,981 - 1,595,077 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DRC3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	60,633,177 - 60,651,849 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	60,633,166 - 60,651,821 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

DRC3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	17,009,632 - 17,056,744 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	17,010,290 - 17,056,733 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	3,851,892 - 3,899,566 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Drc3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624849	3,429,932 - 3,466,481 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624849	3,429,932 - 3,466,172 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Drc3
631 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	33
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000032685
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35893451	64140567	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	18035782	63035782	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
11528631	Bss117	Bone structure and strength QTL 117	6.41	4e-07	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	10	45446681	45933445	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
11528628	Bss116	Bone structure and strength QTL 116	6.46	4e-07	femur morphology trait (VT:0000559)	femur length (CMO:0000442)	10	44679312	46132467	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21833758	61843633	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35893263	64653589	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29800910	64653589	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	27023535	61843633	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35893263	52293000	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	18035782	63035782	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	29377046	52699134	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

BE112807

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	45,199,168 - 45,199,333 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	46,762,050 - 46,762,214	NCBI	Rnor6.0
Rnor_5.0	10	46,517,377 - 46,517,541	UniSTS	Rnor5.0
RGSC_v3.4	10	46,662,462 - 46,662,626	UniSTS	RGSC3.4
Celera	10	44,456,385 - 44,456,549	UniSTS
RH 3.4 Map	10	527.6	UniSTS
Cytogenetic Map	10	q22	UniSTS

AI230942

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	45,174,910 - 45,175,109 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	46,737,793 - 46,737,991	NCBI	Rnor6.0
Rnor_5.0	10	46,492,641 - 46,492,839	UniSTS	Rnor5.0
RGSC_v3.4	10	46,638,205 - 46,638,403	UniSTS	RGSC3.4
Celera	10	44,432,128 - 44,432,326	UniSTS
RH 3.4 Map	10	529.58	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	86	59	6	349	186	11	144	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013857	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032685 ⟹ ENSRNOP00000038778

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	45,658,018 - 45,698,900 (+)	Ensembl
mRatBN7.2 Ensembl	10	45,159,231 - 45,199,369 (+)	Ensembl
Rnor_6.0 Ensembl	10	46,722,109 - 46,762,250 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101100 ⟹ ENSRNOP00000080733

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	45,656,883 - 45,676,803 (+)	Ensembl
mRatBN7.2 Ensembl	10	45,157,354 - 45,182,205 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000151269 ⟹ ENSRNOP00000100747

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	45,656,883 - 45,698,870 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000158365 ⟹ ENSRNOP00000111553

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	45,648,410 - 45,698,890 (+)	Ensembl

RefSeq Acc Id:

NM_001013857 ⟹ NP_001013879

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,658,735 - 45,698,879 (+)	NCBI
mRatBN7.2	10	45,159,231 - 45,199,380 (+)	NCBI
Rnor_6.0	10	46,722,109 - 46,762,261 (+)	NCBI
Rnor_5.0	10	46,466,517 - 46,517,603 (+)	NCBI
RGSC_v3.4	10	46,614,082 - 46,662,673 (+)	RGD
Celera	10	44,416,605 - 44,456,596 (+)	RGD

Sequence:

show sequence

GACGAGGCTACCTGGGTGATTTGTTTGTAAAGCTTTTGGCTGCTTCTCCACATCCTACCTCTGG
TCTTCACCAAGGACATTATCATCAGGAACTGTATGTGAAGGCGGAACCCAATTTCTCAGCAAAG
ATGAGCCGGCCGTATGACTCAATGGAGCCCAAAGTAATGGACGATGACATGCTCAAGGTAGCTG
TTGGGGAGCAAGGGCCCCAGGAAGAGGCTGGGCAGCTAGCCAAGCAGGAAGGCATCCTCTTCAA
AGATGTCCTGGCCCTGCAGCTGGACTTCCAGAATATCCTCCGCATAGATAACCTCTGGCAGTTT
GAGAACCTGCGGAAGCTGCAGCTGAACAACAACATCATTGAGCGGATCGAGGGCCTGGAAAACC
TCACACACCTGGTCTGGCTGGATTTGTCCTTCAACAACATTGAGGCCATTGAGGGCCTGGATAC
CCTGGTCAACCTGGAGGACCTGAGCTTGTCCCATAACCGGATCTCCAAGATAGACTCTCTAGAT
CCCCTGGTGAATCTGCAGGTGCTGTCACTGGGCAATAACCAGATTAACAACATGATGAATATCA
TCTACCTGCGCCGGTTCCCGTGCCTGCGAACACTCAGCCTCTCTGGGAATCCCGTTTCTGAGGC
AGAGGAGTACAAGGTGTTCATCTATGCCTACCTTCCTGATCTCGTGTACCTGGACTTCCGGCGC
GTTGATGAGCAGGCGAGGGAGGTGGCGAAGATGAAGCATCAGTACAGCATTGATGAGCTGAAGC
ACCGGGAGGCACTGATGCAGATCCGGCTGGAGGAGGAGCAGGCCAAGCAGCAGAAGCTGGCAGA
GCATAAGATGGCATTTGTTGAGCACCTGAATGGCCCCTTCCTGTTTGACAGCATGTATTCCGAT
GATGTGGAGGGCAACAAGCTATCCTACCTGCCTGGTGTTGGTGAGCTCCTTGAAGCCTACAAGG
ACAAATTTGTCATCATCTGCCTGAACATTTTCGAGTATGGCCTGAGTCAGCAAGAAAAGCGAAA
GATTGAGTTAGACACCTTCAATGAGTGCATACAGGAGGCCATTCAGGAAAACCAGGACCAGGGC
AAGCTCAAGATTGCCAAGTTTGAGGAAAAACACCTGCTGAACTTAAACGCCATCCGGGAAGAGA
GCGATCTGTTCACCATGGAGCAGAAGCTGACGGAGTGCAATGAGAGCATCACTGAGCTGTTCAA
CACGCTCATGATACTGGAGATGCAGCTGGTGGAGCAGCTGGAGGAGACCATAAATGTATTTGAA
AGAAACATCACTGACTTGGTGGGACTATTTATTGAAAATGTCCAAAGTCTGATCGCCCAGTGCC
GGGACTTGGAGAACCATCACCACGAGAAGCTCCTGGAGATTGCCATCAACACCCTAGAGAAGAT
CCTCAAGGGCGAGATGGATGAGGACTTACCCGATGATGTGCGGGCACTTTTTGTTGACAAAGAC
ACAATTGTTAACGCCGTTGGGGCATCACATGACATCCATCTCCTGAAGATTGACAACCGGGAAG
ATGAGCTGGTGACTGGAGTCAACTCTTGGTGTGCACATCTCGTAGACAAGATTCACAAAGATGA
GATCATGAGGAACCGTAAGCGAGTGAAGGAGATCAATCAATTCGTCGACCATATGCAGAGTGAA
CTGGACAACCTGGAATGTGGTGACATTATAGACTAGGTGTCAGCCATCAGCCAGCGATCCCCTC
TAGAGCATGGACCCAGCCCCTGAGAGTTATGGGATTTCTTTCATTCACCCCTGTCTTAACACTG
TTGGTAATAATTCTCAATATAGAGAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063268613 ⟹ XP_063124683

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,657,835 - 45,698,902 (+)	NCBI

RefSeq Acc Id:

XM_063268614 ⟹ XP_063124684

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,620,045 - 45,698,902 (+)	NCBI

RefSeq Acc Id:

XM_063268615 ⟹ XP_063124685

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,657,683 - 45,698,902 (+)	NCBI

RefSeq Acc Id:

XM_063268616 ⟹ XP_063124686

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,658,099 - 45,698,902 (+)	NCBI

RefSeq Acc Id:

XM_063268617 ⟹ XP_063124687

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,620,045 - 45,698,902 (+)	NCBI

RefSeq Acc Id:

XM_063268618 ⟹ XP_063124688

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,620,045 - 45,698,902 (+)	NCBI

RefSeq Acc Id:

XM_063268619 ⟹ XP_063124689

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,620,045 - 45,698,902 (+)	NCBI

RefSeq Acc Id:

XM_063268620 ⟹ XP_063124690

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,657,834 - 45,698,902 (+)	NCBI

RefSeq Acc Id:

XM_063268621 ⟹ XP_063124691

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,657,832 - 45,698,333 (+)	NCBI

RefSeq Acc Id:

XM_063268622 ⟹ XP_063124692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	45,657,832 - 45,689,086 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013879	(Get FASTA)	NCBI Sequence Viewer
	XP_063124683	(Get FASTA)	NCBI Sequence Viewer
	XP_063124684	(Get FASTA)	NCBI Sequence Viewer
	XP_063124685	(Get FASTA)	NCBI Sequence Viewer
	XP_063124686	(Get FASTA)	NCBI Sequence Viewer
	XP_063124687	(Get FASTA)	NCBI Sequence Viewer
	XP_063124688	(Get FASTA)	NCBI Sequence Viewer
	XP_063124689	(Get FASTA)	NCBI Sequence Viewer
	XP_063124690	(Get FASTA)	NCBI Sequence Viewer
	XP_063124691	(Get FASTA)	NCBI Sequence Viewer
	XP_063124692	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83838	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038778
	ENSRNOP00000038778.4
	ENSRNOP00000100747
	ENSRNOP00000111553
GenBank Protein	Q5XI54	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013879 ⟸ NM_001013857

- UniProtKB:

Q5XI54 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSRPYDSMEPKVMDDDMLKVAVGEQGPQEEAGQLAKQEGILFKDVLALQLDFQNILRIDNLWQF
ENLRKLQLNNNIIERIEGLENLTHLVWLDLSFNNIEAIEGLDTLVNLEDLSLSHNRISKIDSLD
PLVNLQVLSLGNNQINNMMNIIYLRRFPCLRTLSLSGNPVSEAEEYKVFIYAYLPDLVYLDFRR
VDEQAREVAKMKHQYSIDELKHREALMQIRLEEEQAKQQKLAEHKMAFVEHLNGPFLFDSMYSD
DVEGNKLSYLPGVGELLEAYKDKFVIICLNIFEYGLSQQEKRKIELDTFNECIQEAIQENQDQG
KLKIAKFEEKHLLNLNAIREESDLFTMEQKLTECNESITELFNTLMILEMQLVEQLEETINVFE
RNITDLVGLFIENVQSLIAQCRDLENHHHEKLLEIAINTLEKILKGEMDEDLPDDVRALFVDKD
TIVNAVGASHDIHLLKIDNREDELVTGVNSWCAHLVDKIHKDEIMRNRKRVKEINQFVDHMQSE
LDNLECGDIID

hide sequence

Ensembl Acc Id:

ENSRNOP00000038778 ⟸ ENSRNOT00000032685

Ensembl Acc Id:

ENSRNOP00000080733 ⟸ ENSRNOT00000101100

RefSeq Acc Id:	XP_063124687 ⟸ XM_063268617
- Peptide Label:	isoform X1
- UniProtKB:	Q5XI54 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063124684 ⟸ XM_063268614
- Peptide Label:	isoform X1
- UniProtKB:	Q5XI54 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063124688 ⟸ XM_063268618
- Peptide Label:	isoform X1
- UniProtKB:	Q5XI54 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063124689 ⟸ XM_063268619
- Peptide Label:	isoform X1
- UniProtKB:	Q5XI54 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063124685 ⟸ XM_063268615
- Peptide Label:	isoform X1
- UniProtKB:	Q5XI54 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063124691 ⟸ XM_063268621
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063124692 ⟸ XM_063268622
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063124690 ⟸ XM_063268620
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063124683 ⟸ XM_063268613
- Peptide Label:	isoform X1
- UniProtKB:	Q5XI54 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063124686 ⟸ XM_063268616
- Peptide Label:	isoform X1
- UniProtKB:	Q5XI54 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000100747 ⟸ ENSRNOT00000151269

Ensembl Acc Id:

ENSRNOP00000111553 ⟸ ENSRNOT00000158365

Protein Domains

LRRCT

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XI54-F1-model_v2	AlphaFold	Q5XI54	1-523	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309150	AgrOrtholog
BioCyc Gene	G2FUF-24860	BioCyc
Ensembl Genes	ENSRNOG00000021303	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000032685	ENTREZGENE
	ENSRNOT00000032685.5	UniProtKB/Swiss-Prot
	ENSRNOT00000151269	ENTREZGENE
	ENSRNOT00000158365	ENTREZGENE
Gene3D-CATH	3.80.10.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7113397	IMAGE-MGC_LOAD
InterPro	Cilia_flagella_integrity	UniProtKB/Swiss-Prot
	Leu-rich_rpt	UniProtKB/Swiss-Prot
	Leu-rich_rpt_typical-subtyp	UniProtKB/Swiss-Prot
	LRR_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:287371	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94955	IMAGE-MGC_LOAD
NCBI Gene	287371	ENTREZGENE
PANTHER	DYNEIN REGULATORY COMPLEX SUBUNIT 3	UniProtKB/Swiss-Prot
	PROTEIN PHOSPHATASE 1 REGULATORY SUBUNIT SDS22-RELATED	UniProtKB/Swiss-Prot
Pfam	LRR_9	UniProtKB/Swiss-Prot
PhenoGen	Drc3	PhenoGen
PROSITE	LRR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000021303	RatGTEx
SMART	LRR_SD22	UniProtKB/Swiss-Prot
	LRR_TYP	UniProtKB/Swiss-Prot
Superfamily-SCOP	L domain-like	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZQF1_RAT	UniProtKB/TrEMBL
	A0ABK0LKS2_RAT	UniProtKB/TrEMBL
	DRC3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-10-14	Drc3	dynein regulatory complex subunit 3	Lrrc48	leucine rich repeat containing 48	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-07-29	Lrrc48	leucine rich repeat containing 48	LOC691364	similar to glyceraldehyde-3-phosphate dehydrogenase, spermatogenic	Data merged from RGD:1585053	737654	PROVISIONAL
2006-11-19	LOC691364	similar to glyceraldehyde-3-phosphate dehydrogenase, spermatogenic			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-30	Lrrc48	leucine rich repeat containing 48	RGD1309150	similar to RIKEN cDNA 4930449E07	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1309150	similar to RIKEN cDNA 4930449E07	RGD1309150_predicted	similar to RIKEN cDNA 4930449E07 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1309150_predicted	similar to RIKEN cDNA 4930449E07 (predicted)	LOC287371_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC287371_predicted	similar to RIKEN cDNA 4930449E07 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message