Advanced Search (OLGA)

Gene: Mrps26 (mitochondrial ribosomal protein S26) Rattus norvegicus

Analyze

Symbol:

Mrps26

Name:

mitochondrial ribosomal protein S26

RGD ID:

1308733

Description:

Predicted to be located in mitochondrion and ribosome. Predicted to be part of mitochondrial small ribosomal subunit. Orthologous to human MRPS26 (mitochondrial ribosomal protein S26); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

28S ribosomal protein S26, mitochondrial; 5 ' OT-EST gene; 5 ' OT-EST protein; 5'OT-EST; LOC362216; MRP-S26; S26mt; small ribosomal subunit protein mS26

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPS26 (mitochondrial ribosomal protein S26)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mrps26 (mitochondrial ribosomal protein S26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mrps26 (mitochondrial ribosomal protein S26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPS26 (mitochondrial ribosomal protein S26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPS26 (mitochondrial ribosomal protein S26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrps26 (mitochondrial ribosomal protein S26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPS26 (mitochondrial ribosomal protein S26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRPS26 (mitochondrial ribosomal protein S26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrps26 (mitochondrial ribosomal protein S26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mrps26 (mitochondrial ribosomal protein S26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MRPS26 (mitochondrial ribosomal protein S26)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrps26 (mitochondrial ribosomal protein S26)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrps26 (mitochondrial ribosomal protein S26)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mrps-26	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	mrps-26	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mRpS26	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mRpS26	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mrps26	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	138,222,324 - 138,223,987 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	138,222,165 - 138,223,987 (+)	Ensembl				GRCr8
mRatBN7.2	3	117,769,220 - 117,770,883 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	117,769,100 - 117,770,885 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	121,663,663 - 121,665,327 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	130,260,929 - 130,262,593 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	127,919,796 - 127,921,460 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	123,093,264 - 123,094,927 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	123,093,264 - 123,094,927 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	129,591,392 - 129,593,055 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	118,180,789 - 118,182,452 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	116,580,079 - 116,581,742 (+)	NCBI		Celera
RGSC_v3.1	3	118,086,361 - 118,088,021 (+)	NCBI
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

celecoxib (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

clobetasol (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

dibenzo[a,l]pyrene (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

L-methionine (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

methidathion (ISO)

N-nitrosodiethylamine (EXP)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

thiram (ISO)

titanium dioxide (ISO)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrial small ribosomal subunit (IBA,IEA,ISS)

mitochondrion (IEA,ISO)

ribonucleoprotein complex (IEA)

ribosome (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9857009	PMID:18614015	PMID:22681889

Genomics

Comparative Map Data

Mrps26
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	138,222,324 - 138,223,987 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	138,222,165 - 138,223,987 (+)	Ensembl				GRCr8
mRatBN7.2	3	117,769,220 - 117,770,883 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	117,769,100 - 117,770,885 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	121,663,663 - 121,665,327 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	130,260,929 - 130,262,593 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	127,919,796 - 127,921,460 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	123,093,264 - 123,094,927 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	123,093,264 - 123,094,927 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	129,591,392 - 129,593,055 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	118,180,789 - 118,182,452 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	116,580,079 - 116,581,742 (+)	NCBI		Celera
RGSC_v3.1	3	118,086,361 - 118,088,021 (+)	NCBI
Cytogenetic Map	3	q36	NCBI

MRPS26
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	3,046,052 - 3,048,250 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	3,046,041 - 3,048,254 (+)	Ensembl			hg38	GRCh38
GRCh37	20	3,026,698 - 3,028,896 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	2,974,675 - 2,976,896 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	20	2,974,674 - 2,976,895	NCBI
Celera	20	3,088,662 - 3,090,883 (+)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	2,973,007 - 2,975,228 (+)	NCBI		HuRef
CHM1_1	20	3,021,504 - 3,023,725 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	3,076,798 - 3,078,996 (+)	NCBI		T2T-CHM13v2.0

Mrps26
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	130,405,677 - 130,407,314 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	130,405,662 - 130,410,615 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	130,563,757 - 130,565,394 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	130,563,742 - 130,568,695 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	130,389,493 - 130,391,130 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	130,255,198 - 130,256,835 (+)	NCBI		MGSCv36	mm8
Celera	2	131,788,181 - 131,789,818 (+)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	63.24	NCBI

Mrps26
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	13,974,393 - 13,976,839 (+)	Ensembl
ChiLan1.0	NW_004955415	13,974,393 - 13,976,839 (+)	NCBI	ChiLan1.0	ChiLan1.0

MRPS26
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	20	4,010,297 - 4,012,746 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	3,132,569 - 3,134,896 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	2,895,626 - 2,897,278 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

MRPS26
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	18,215,055 - 18,216,993 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	18,215,055 - 18,217,333 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	18,043,386 - 18,045,377 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	18,633,886 - 18,635,881 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	18,633,886 - 18,635,811 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	18,227,065 - 18,229,060 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	18,339,756 - 18,341,752 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	18,667,533 - 18,669,528 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mrps26
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	167,303,658 - 167,305,492 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	15,730,698 - 15,736,916 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	15,735,022 - 15,736,852 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPS26
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	32,629,284 - 32,631,430 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	32,629,281 - 32,631,434 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	36,999,771 - 37,001,920 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPS26
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	33,725,930 - 33,728,206 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	33,726,001 - 33,727,824 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666071	10,786,696 - 10,789,029 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrps26
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	4,164,440 - 4,165,963 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624741	4,164,156 - 4,166,303 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mrps26
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	110,300,478 - 110,302,137 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mrps26
4 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	30
Count of miRNA genes:	29
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000028828
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	96509147	141509147	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	104545086	149545086	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	93829559	138829559	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	112250810	157250810	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	96509147	141509147	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	117537367	162537367	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	110225882	155225882	Rat
1358204	Insglur1	Insulin/glucose ratio QTL 1	3.8		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	3	136091420	155634702	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	90755164	141509147	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	122395989	167395989	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	137114333	182114333	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	125814931	139636791	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	110634702	155634702	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	116188400	161188400	Rat

Markers in Region

RH133467

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	117,770,624 - 117,770,824 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	123,094,669 - 123,094,868	NCBI	Rnor6.0
Rnor_5.0	3	129,592,797 - 129,592,996	UniSTS	Rnor5.0
RGSC_v3.4	3	118,182,194 - 118,182,393	UniSTS	RGSC3.4
Celera	3	116,581,484 - 116,581,683	UniSTS
RH 3.4 Map	3	1001.8	UniSTS
Cytogenetic Map	3	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ131196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028828 ⟹ ENSRNOP00000028828

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	138,222,165 - 138,223,987 (+)	Ensembl
mRatBN7.2 Ensembl	3	117,769,100 - 117,770,885 (+)	Ensembl
Rnor_6.0 Ensembl	3	123,093,264 - 123,094,927 (+)	Ensembl

RefSeq Acc Id:

NM_001013206 ⟹ NP_001013224

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	138,222,324 - 138,223,987 (+)	NCBI
mRatBN7.2	3	117,769,220 - 117,770,883 (+)	NCBI
Rnor_6.0	3	123,093,264 - 123,094,927 (+)	NCBI
Rnor_5.0	3	129,591,392 - 129,593,055 (+)	NCBI
RGSC_v3.4	3	118,180,789 - 118,182,452 (+)	RGD
Celera	3	116,580,079 - 116,581,742 (+)	RGD

Sequence:

show sequence

GTGATGCTCCTCGACCACTTCCGGACAGGGCGCAGGCGCTAGCTGTCATGTTGCGGGCTTTGAA
CCGCCTGGCCGCGCGGCCCGGGGGCCAGCCCCCAACCCTGCTCCTTCTGCCCGTGCGCGGCCGC
AAGACCCGCCACGATCCGCCTGCCAAGTCCAAGGTCGGGCGCGTGAAAATGCCTCCTGCAGTGG
ACCCTGCGGAATTGTTCGTGTTGACCGAGCGCTACCGACAGTACCGGGAGACGGTGCGCGCTCT
CAGGCGAGAGTTCACATTGGAGGTGCGAGGGAAATTGCACGAGGCCCGAGCCGGGGTTCTGGCT
GAGCGCAAGGCGCAAGAGGCCATCAGAGAGCACCAGGAGCTGATGGCCTGGAACCGGGAGGAGA
ACCGGAGACTGCAGGAACTACGGATAGCTAGGTTGCAGCTCGAAGCACAGGCCCAGGAGCTGCG
GCAGGCTGAGGTCCAGGCCCAGAGGGCCCAGGAGGAGCAGGCTTGGGTGCAACTGAAAGAACAA
GAAGTTCTCAAACTGCAGGAGGAGGCCAAAAACTTCATCACTCGGGAGAACCTGGAGGCACGGA
TAGAAGAGGCCTTGGACTCTCCGAAGAGTTATAACTGGGCGGTCACCAAAGAAGGGCAGGTGGT
CAGGAACTGAGAACAGAGGCCTCTCAGGCCCAAATAAGGACAGTGCTTGCCTAGGGACTGGATA
TTGGGGTAGAAATTGGTGCATCCCAGGAGGGTGGCACAGCCTTGTCCAGAGCAGCCCCCATTCA
TTCTAGATTTGGCACCAGGTATAGTACCTGTTCTGACACCACATACAAACTCCGGACAGCATTA
AACTCTGGGAAGTTCCTATCACACAGAAGATCAGACTGGACTGTCCCCTCTAGAAGCCAAGAGC
TGTCTCCTGAGTTTCTTGGAATAGTGTGAGCCCAATGTTTCCTGCTTTTATAAATAAACTATTG
GAAAGCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013224	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAC20860	(Get FASTA)	NCBI Sequence Viewer
	EDL80197	(Get FASTA)	NCBI Sequence Viewer
	EDL80198	(Get FASTA)	NCBI Sequence Viewer
	EDL80199	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028828
GenBank Protein	Q9EPJ3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001013224 ⟸ NM_001013206
- Peptide Label:	precursor
- UniProtKB:	Q9EPJ3 (UniProtKB/Swiss-Prot), A0A8L2QFW5 (UniProtKB/TrEMBL), A6HQ96 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLRALNRLAARPGGQPPTLLLLPVRGRKTRHDPPAKSKVGRVKMPPAVDPAELFVLTERYRQYR ETVRALRREFTLEVRGKLHEARAGVLAERKAQEAIREHQELMAWNREENRRLQELRIARLQLEA QAQELRQAEVQAQRAQEEQAWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDSPKSYNWAVT KEGQVVRN hide sequence

Ensembl Acc Id:

ENSRNOP00000028828 ⟸ ENSRNOT00000028828

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EPJ3-F1-model_v2	AlphaFold	Q9EPJ3	1-200	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692435

Promoter ID:

EPDNEW_R2959

Type:

initiation region

Name:

Mrps26_1

Description:

mitochondrial ribosomal protein S26

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	123,093,290 - 123,093,350	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308733	AgrOrtholog
BioCyc Gene	G2FUF-47854	BioCyc
Ensembl Genes	ENSRNOG00000021224	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000028828	ENTREZGENE
InterPro	MRPS26	UniProtKB/Swiss-Prot
KEGG Report	rno:362216	UniProtKB/Swiss-Prot
NCBI Gene	362216	ENTREZGENE
PANTHER	28S RIBOSOMAL PROTEIN S26, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR21035	UniProtKB/Swiss-Prot
Pfam	MRP-S26	UniProtKB/Swiss-Prot
PhenoGen	Mrps26	PhenoGen
RatGTEx	ENSRNOG00000021224	RatGTEx
UniProt	A0A8L2QFW5	ENTREZGENE, UniProtKB/TrEMBL
	A6HQ96	ENTREZGENE, UniProtKB/TrEMBL
	Q9EPJ3	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Mrps26	mitochondrial ribosomal protein S26	Mrps26_predicted	mitochondrial ribosomal protein S26 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Mrps26_predicted	mitochondrial ribosomal protein S26 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message