Advanced Search (OLGA)

Gene: Dusp19 (dual specificity phosphatase 19) Rattus norvegicus

Analyze

Symbol:

Dusp19

Name:

dual specificity phosphatase 19

RGD ID:

1307457

Description:

Predicted to enable JUN kinase phosphatase activity. Predicted to be involved in regulation of JNK cascade. Predicted to be active in cytoplasm. Orthologous to human DUSP19 (dual specificity phosphatase 19); PARTICIPATES IN c-Jun N-terminal kinases MAPK signaling pathway; INTERACTS WITH amphetamine; bisphenol A; cobalt dichloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

dual specificity protein phosphatase 19; LOC311151

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DUSP19 (dual specificity phosphatase 19)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dusp19 (dual specificity phosphatase 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dusp19 (dual specificity phosphatase 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DUSP19 (dual specificity phosphatase 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DUSP19 (dual specificity phosphatase 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dusp19 (dual specificity phosphatase 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DUSP19 (dual specificity phosphatase 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DUSP19 (dual specificity phosphatase 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dusp19 (dual specificity phosphatase 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Dusp19 (dual specificity phosphatase 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DUSP19 (dual specificity phosphatase 19)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dusp19 (dual specificity phosphatase 19)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dusp19a (dual specificity phosphatase 19a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dusp19b (dual specificity phosphatase 19b)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	dusp19b (dual specificity phosphatase 19b)	Alliance	DIOPT (OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	Y54F10BM.13	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y54F10BM.13	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mkp	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mkp	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dusp19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	85,945,289 - 86,081,289 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	3	65,538,424 - 65,554,465 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	65,538,420 - 65,553,534 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	68,890,852 - 68,903,336 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	77,474,410 - 77,486,894 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	75,234,840 - 75,250,812 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	3	83,736,947 - 83,752,905 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	3	90,659,332 - 90,675,288 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	3	82,581,692 - 82,597,648 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	3	63,880,293 - 63,892,779 (+)	NCBI		F344_StmMcwi
Rnor_6.0	3	67,849,966 - 67,862,475 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	67,849,966 - 67,862,475 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	74,406,311 - 74,418,820 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	63,473,333 - 63,485,843 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	64,984,512 - 64,997,042 (+)	NCBI		Celera
RGSC_v3.1	3	63,369,862 - 63,382,210 (+)	NCBI
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

amphetamine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glycidol (EXP)

hydrogen peroxide (ISO)

hydroquinone (ISO)

indole-3-methanol (EXP)

lipopolysaccharide (ISO)

methylisothiazolinone (ISO)

N(4)-hydroxycytidine (ISO)

okadaic acid (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

theophylline (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

JNK cascade (ISO)

negative regulation of JNK cascade (ISO)

negative regulation of MAPK cascade (ISO)

positive regulation of JNK cascade (ISO)

positive regulation of MAPK cascade (ISO)

protein dephosphorylation (ISO)

Cellular Component

cytoplasm (ISO)

Molecular Function

JUN kinase phosphatase activity (ISO)

MAP-kinase scaffold activity (ISO)

mitogen-activated protein kinase kinase binding (ISO)

mitogen-activated protein kinase kinase kinase binding (ISO)

protein binding (ISO)

protein kinase activator activity (ISO)

protein kinase inhibitor activity (ISO)

protein tyrosine/serine/threonine phosphatase activity (ISO)

protein tyrosine/threonine phosphatase activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

c-Jun N-terminal kinases MAPK signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	Scaffold role of a mitogen-activated protein kinase phosphatase, SKRP1, for the JNK signaling pathway.	Zama T, etal., J Biol Chem. 2002 Jun 28;277(26):23919-26. Epub 2002 Apr 16.

Additional References at PubMed

PMID:11432789	PMID:11959861	PMID:26751999	PMID:29174854

Genomics

Comparative Map Data

Dusp19
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	85,945,289 - 86,081,289 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	3	65,538,424 - 65,554,465 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	65,538,420 - 65,553,534 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	68,890,852 - 68,903,336 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	77,474,410 - 77,486,894 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	75,234,840 - 75,250,812 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	3	83,736,947 - 83,752,905 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	3	90,659,332 - 90,675,288 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	3	82,581,692 - 82,597,648 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	3	63,880,293 - 63,892,779 (+)	NCBI		F344_StmMcwi
Rnor_6.0	3	67,849,966 - 67,862,475 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	67,849,966 - 67,862,475 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	74,406,311 - 74,418,820 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	63,473,333 - 63,485,843 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	64,984,512 - 64,997,042 (+)	NCBI		Celera
RGSC_v3.1	3	63,369,862 - 63,382,210 (+)	NCBI
Cytogenetic Map	3	q24	NCBI

DUSP19
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	183,078,747 - 183,100,008 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	183,078,559 - 183,100,008 (+)	Ensembl			hg38	GRCh38
GRCh37	2	183,943,475 - 183,964,736 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	183,651,732 - 183,672,981 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	183,768,992 - 183,790,226	NCBI
Celera	2	177,539,400 - 177,560,844 (+)	NCBI		Celera
Cytogenetic Map	2	q32.1	NCBI
HuRef	2	175,802,186 - 175,823,524 (+)	NCBI		HuRef
CHM1_1	2	183,949,183 - 183,970,629 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	183,567,739 - 183,589,000 (+)	NCBI		T2T-CHM13v2.0

Dusp19
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	80,447,558 - 80,462,005 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	80,447,389 - 80,462,705 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	80,617,214 - 80,631,661 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	80,617,045 - 80,632,361 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	80,457,371 - 80,471,818 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	80,418,053 - 80,432,500 (+)	NCBI		MGSCv36	mm8
Celera	2	82,284,005 - 82,298,452 (+)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	48.31	NCBI

Dusp19
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	14,420,243 - 14,440,210 (-)	Ensembl
ChiLan1.0	NW_004955403	14,421,057 - 14,439,829 (-)	NCBI	ChiLan1.0	ChiLan1.0

DUSP19
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	85,736,631 - 85,763,434 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	85,751,609 - 85,778,412 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	70,347,712 - 70,371,852 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	188,157,061 - 188,178,277 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	188,157,061 - 188,178,266 (+)	Ensembl			panPan2	panpan1.1

DUSP19
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	26,095,436 - 26,111,700 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	26,095,463 - 26,111,774 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	25,992,877 - 26,008,486 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	26,249,353 - 26,265,172 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	26,247,729 - 26,270,212 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	26,375,521 - 26,391,166 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	26,306,406 - 26,322,096 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	26,448,561 - 26,464,353 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Dusp19
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	143,099,366 - 143,118,272 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	11,653,199 - 11,672,476 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	11,653,282 - 11,670,425 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DUSP19
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	88,549,275 - 88,571,883 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	88,549,250 - 88,574,978 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	98,104,160 - 98,124,373 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DUSP19
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	68,582,797 - 68,607,249 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	68,583,314 - 68,610,537 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	130,937,243 - 130,956,474 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dusp19
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624844	4,798,455 - 4,818,818 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624844	4,798,542 - 4,822,739 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dusp19
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	57,796,803 - 57,809,078 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dusp19
856 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	115
Count of miRNA genes:	88
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000057826
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	59863663	87321459	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	87321459	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	85062224	136118980	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	85062224	136118980	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	81541464	126563126	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Markers in Region

RH138513

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	65,550,632 - 65,550,796 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	67,862,194 - 67,862,357	NCBI	Rnor6.0
Rnor_5.0	3	74,418,539 - 74,418,702	UniSTS	Rnor5.0
RGSC_v3.4	3	63,485,562 - 63,485,725	UniSTS	RGSC3.4
Celera	3	64,996,761 - 64,996,924	UniSTS
Cytogenetic Map	3	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	88	59	6	352	188	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000057826 ⟹ ENSRNOP00000054636

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	65,538,420 - 65,553,534 (+)	Ensembl
Rnor_6.0 Ensembl	3	67,849,966 - 67,862,475 (+)	Ensembl

RefSeq Acc Id:

NM_001107739 ⟹ NP_001101209

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,945,303 - 85,957,813 (+)	NCBI
mRatBN7.2	3	65,538,424 - 65,550,914 (+)	NCBI
Dahl_SR_JrHsd	3	83,736,947 - 83,752,905 (+)	NCBI
Lyon_Normotensive	3	90,659,332 - 90,675,288 (+)	NCBI
Lyon_Hypertensive	3	82,581,692 - 82,597,648 (+)	NCBI
F344_StmMcwi	3	63,880,293 - 63,892,779 (+)	NCBI
Rnor_6.0	3	67,849,966 - 67,862,475 (+)	NCBI
Rnor_5.0	3	74,406,311 - 74,418,820 (+)	NCBI
RGSC_v3.4	3	63,473,333 - 63,485,843 (+)	RGD
Celera	3	64,984,512 - 64,997,042 (+)	RGD

Sequence:

show sequence

GGGCTGCTCTCTTCTCTCCAGGAGGTGAGGTTGTCACTGCAGGGGCCAGCTCCGCTAAGTGACT
AGTGGCTGACTAGCCCTGCAGCGTGCAGTGCCTTCCCCCCCCTTCTTTCTTTCTTTTTTTTTTT
CCTTGCTGCTTTTCCTCCTTCGCTCATGTAATGCACTCCCTGAACCAAGAAATCAAAGCATTCT
CCCGGGATAATCTCAGGAAGCAGTGCACCAGGGTGACCACGCTAACTGGAAAGAAACTTATAGA
AACTTGGAAAGATGCCACAGTTCATGTTGTGGAAACAGAGACCAGCGGTGGGGGTGGTTGTGGC
TATGTGCAGGACCTTACCTTGGACCTGCAAGTTGGCGTTATTAAGCCCTGGTTGCTTCTGGGGT
CCCAGGATGCTGCGCATGATCTGGAGCTACTGAGACAGCACAAGGTGACCCATATTCTCAACGT
CGCGTATGGAGTTGAGAACGTTTTCCTCAGTGAGTTTACATATAAGACCATTTCTATACTGGAT
GTGCCTGAAACCAATATCCTGTCCTATTTTCCAGAATGTTTTGAGTTTATTGAGCAAGCAAAAC
TGAAGGATGGCGTGGTTCTTGTCCACTGTAACGCAGGGGTTTCCAGGGCTGCTGCGGTTGTCAT
CGGCTTCCTCATGAGTTCTGAAGAACTTGCTTTCACCAATGCTTTGTCGTTGGTGAAAGAGGCA
AGACCATCCATATGTCTGAATCCTGGCTTCATGGAACAACTCCGCACCTACCGAGTAGGCAAAG
AGAGCAATGGAGGTGACCAAGTGCCCGCAGTGGCCACCGACCATGGTCCGTGATCTGTACTCTA
GCTGAGGCAAACTACTTATGCATCTGCCTCTGCCCTCTCGCCTGTGTTTTGGACGGTAACTTGT
AAAGCTTCCCTTTTCTGTTGTCTTTTACCAGTGGAAATGGAAGCTACTTTTGTCGACCGGAATT
AATACATTTTTACATTTTACCTTT

hide sequence

RefSeq Acc Id:

XM_039104869 ⟹ XP_038960797

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,945,289 - 85,966,192 (+)	NCBI
mRatBN7.2	3	65,538,439 - 65,554,465 (+)	NCBI

RefSeq Acc Id:

XM_063283644 ⟹ XP_063139714

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,945,333 - 86,080,843 (+)	NCBI

RefSeq Acc Id:

XM_063283645 ⟹ XP_063139715

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,945,333 - 86,081,289 (+)	NCBI

RefSeq Acc Id:

XM_063283646 ⟹ XP_063139716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,945,333 - 86,081,267 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101209	(Get FASTA)	NCBI Sequence Viewer
	XP_038960797	(Get FASTA)	NCBI Sequence Viewer
	XP_063139714	(Get FASTA)	NCBI Sequence Viewer
	XP_063139715	(Get FASTA)	NCBI Sequence Viewer
	XP_063139716	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79284	(Get FASTA)	NCBI Sequence Viewer
	EDL79285	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001101209 ⟸ NM_001107739

- UniProtKB:

A6HMN2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATVHVVETETSGGGGCGYVQDLTLDLQ
VGVIKPWLLLGSQDAAHDLELLRQHKVTHILNVAYGVENVFLSEFTYKTISILDVPETNILSYF
PECFEFIEQAKLKDGVVLVHCNAGVSRAAAVVIGFLMSSEELAFTNALSLVKEARPSICLNPGF
MEQLRTYRVGKESNGGDQVPAVATDHGP

hide sequence

Ensembl Acc Id:

ENSRNOP00000054636 ⟸ ENSRNOT00000057826

RefSeq Acc Id:	XP_038960797 ⟸ XM_039104869
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063139715 ⟸ XM_063283645
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063139716 ⟸ XM_063283646
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063139714 ⟸ XM_063283644
- Peptide Label:	isoform X1

Protein Domains

Tyrosine specific protein phosphatases Tyrosine-protein phosphatase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A8F3-F1-model_v2	AlphaFold	D4A8F3	1-220	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692172

Promoter ID:

EPDNEW_R2696

Type:

initiation region

Name:

Dusp19_1

Description:

dual specificity phosphatase 19

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R2697

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	67,849,966 - 67,850,026	EPDNEW

RGD ID:

13692173

Promoter ID:

EPDNEW_R2697

Type:

single initiation site

Name:

Dusp19_2

Description:

dual specificity phosphatase 19

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R2696

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	67,850,099 - 67,850,159	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307457	AgrOrtholog
BioCyc Gene	G2FUF-49223	BioCyc
Ensembl Genes	ENSRNOG00000008868	Ensembl
Gene3D-CATH	3.90.190.10	UniProtKB/TrEMBL
InterPro	Dual-sp/Tyr_phosphatase	UniProtKB/TrEMBL
	Dual-sp_phosphatase_cat-dom	UniProtKB/TrEMBL
	Dual-sp_phosphatase_subgr_cat	UniProtKB/TrEMBL
	Prot-tyrosine_phosphatase-like	UniProtKB/TrEMBL
KEGG Report	rno:311151	UniProtKB/TrEMBL
NCBI Gene	311151	ENTREZGENE
PANTHER	DUAL SPECIFICITY PROTEIN PHOSPHATASE 19	UniProtKB/TrEMBL
	DUAL SPECIFICITY PROTEIN PHOSPHATASE 19	UniProtKB/TrEMBL
Pfam	DSPc	UniProtKB/TrEMBL
PhenoGen	Dusp19	PhenoGen
PRINTS	ADSPHPHTASE	UniProtKB/TrEMBL
PROSITE	TYR_PHOSPHATASE_2	UniProtKB/TrEMBL
	TYR_PHOSPHATASE_DUAL	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008868	RatGTEx
SMART	DSPc	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52799	UniProtKB/TrEMBL
UniProt	A6HMN2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Dusp19	dual specificity phosphatase 19	Dusp19_predicted	dual specificity phosphatase 19 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Dusp19_predicted	dual specificity phosphatase 19 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations