Advanced Search (OLGA)

Gene: C1qtnf12 (C1q and TNF related 12) Rattus norvegicus

Analyze

Symbol:

C1qtnf12

Name:

C1q and TNF related 12

RGD ID:

1307059

Description:

Predicted to enable hormone activity. Predicted to be involved in negative regulation of gluconeogenesis; positive regulation of D-glucose import; and positive regulation of insulin receptor signaling pathway. Predicted to act upstream of or within negative regulation of inflammatory response; positive regulation of cell communication; and regulation of glucose metabolic process. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human C1QTNF12 (C1q and TNF related 12); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

adipolin; C1q and tumor necrosis factor related protein 12; C1q domain containing 2; C1qdc2; Fam132a; family with sequence similarity 132, member A; LOC313774; RGD1307059; similar to RIKEN cDNA 1110035L05

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	C1QTNF12 (C1q and TNF related 12)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	C1qtnf12 (C1q and tumor necrosis factor related 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	C1qtnf12 (C1q and TNF related 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	C1QTNF12 (C1q and TNF related 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	C1QTNF12 (C1q and TNF related 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	C1qtnf12 (C1q and TNF related 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	C1QTNF12 (C1q and TNF related 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	C1QTNF12 (C1q and TNF related 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	C1qtnf12 (C1q and TNF related 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	C1qtnf12 (C1q and TNF related 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	C1qtnf12 (C1q and tumor necrosis factor related 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	C1QTNF12 (C1q and TNF related 12)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	C1QTNF12 (C1q and TNF related 12)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	c1qtnf12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	c1qtnf12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	c1qtnf12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	c1qtnf12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	171,833,854 - 171,838,229 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	171,833,854 - 171,838,800 (+)	Ensembl				GRCr8
mRatBN7.2	5	166,551,628 - 166,556,003 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,551,628 - 166,556,003 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	169,256,387 - 169,260,762 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	171,077,811 - 171,082,186 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	171,040,345 - 171,044,720 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	173,390,901 - 173,395,276 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,390,901 - 173,395,276 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	176,866,521 - 176,870,896 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	172,801,076 - 172,805,451 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	164,752,352 - 164,756,727 (+)	NCBI		Celera
RGSC_v3.1	5	172,811,832 - 172,815,944 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amphetamine (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

chlordecone (ISO)

ciguatoxin CTX1B (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

folic acid (ISO)

glycidol (EXP)

paracetamol (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sunitinib (ISO)

testosterone (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of gluconeogenesis (IBA,ISO)

negative regulation of inflammatory response (ISO)

positive regulation of D-glucose import across plasma membrane (IBA,ISO)

positive regulation of insulin receptor signaling pathway (IBA,ISO)

positive regulation of insulin secretion involved in cellular response to glucose stimulus (ISO)

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO)

regulation of D-glucose import across plasma membrane (IEA,ISO)

regulation of glucose metabolic process (ISO)

signal transduction (IEA)

Cellular Component

extracellular region (IEA,ISO)

extracellular space (IBA,IEA,ISO)

Molecular Function

hormone activity (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:21849507	PMID:22275362	PMID:32009080

Genomics

Comparative Map Data

C1qtnf12
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	171,833,854 - 171,838,229 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	171,833,854 - 171,838,800 (+)	Ensembl				GRCr8
mRatBN7.2	5	166,551,628 - 166,556,003 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,551,628 - 166,556,003 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	169,256,387 - 169,260,762 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	171,077,811 - 171,082,186 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	171,040,345 - 171,044,720 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	173,390,901 - 173,395,276 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,390,901 - 173,395,276 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	176,866,521 - 176,870,896 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	172,801,076 - 172,805,451 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	164,752,352 - 164,756,727 (+)	NCBI		Celera
RGSC_v3.1	5	172,811,832 - 172,815,944 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

C1QTNF12
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	1,242,453 - 1,247,280 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	1,242,446 - 1,246,722 (-)	Ensembl			hg38	GRCh38
GRCh37	1	1,177,833 - 1,182,102 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	1,167,696 - 1,171,965 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	1,400,244 - 1,405,607 (+)	NCBI		Celera
Cytogenetic Map	1	p36.33	NCBI
CHM1_1	1	1,164,855 - 1,169,130 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	670,953 - 676,213 (-)	NCBI		T2T-CHM13v2.0

C1qtnf12
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	156,046,769 - 156,051,086 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	156,046,775 - 156,051,086 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	155,962,312 - 155,966,629 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	155,962,318 - 155,966,629 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	155,336,427 - 155,340,738 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	154,806,118 - 154,810,429 (+)	NCBI		MGSCv36	mm8
Celera	4	158,225,295 - 158,229,577 (+)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	87.66	NCBI

C1qtnf12
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	9,541,367 - 9,547,097 (+)	Ensembl
ChiLan1.0	NW_004955486	9,541,466 - 9,545,231 (+)	NCBI	ChiLan1.0	ChiLan1.0

C1QTNF12
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	226,978,827 - 226,985,877 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	225,674,168 - 225,682,605 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1 Ensembl	1	1,200,756 - 1,205,301 (-)	Ensembl			panPan2	panpan1.1

C1QTNF12
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	56,433,555 - 56,438,419 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	56,433,552 - 56,438,339 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	56,510,469 - 56,515,396 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	56,636,393 - 56,641,320 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	56,636,384 - 56,641,168 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	56,627,126 - 56,632,053 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	56,519,406 - 56,524,333 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	56,909,407 - 56,914,334 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

C1qtnf12
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	27,584,597 - 27,588,767 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936737	1,877,191 - 1,881,360 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936737	1,877,428 - 1,881,345 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C1QTNF12
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	63,548,864 - 63,553,332 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	63,548,862 - 63,555,991 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	57,983,314 - 57,989,401 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

C1QTNF12
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	130,195,746 - 130,204,338 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	130,198,005 - 130,202,441 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666054	34,766,506 - 34,771,227 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

C1qtnf12
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	8,348,758 - 8,352,150 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624818	8,347,292 - 8,352,160 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

C1qtnf12
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	4,683,841 - 4,688,584 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	22
Count of miRNA genes:	18
Interacting mature miRNAs:	22
Transcripts:	ENSRNOT00000027055
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	156396728	172190305	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	160071170	172129029	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	148093485	172129029	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat

Markers in Region

D5Got121

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	166,550,369 - 166,550,476 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	173,389,643 - 173,389,749	NCBI	Rnor6.0
Rnor_5.0	5	176,865,263 - 176,865,369	UniSTS	Rnor5.0
RGSC_v3.4	5	172,799,817 - 172,799,924	RGD	RGSC3.4
RGSC_v3.4	5	172,799,818 - 172,799,924	UniSTS	RGSC3.4
Celera	5	164,751,094 - 164,751,200	UniSTS
RGSC_v3.1	5	172,810,313 - 172,810,419	RGD
RH 3.4 Map	5	1182.0	UniSTS
RH 3.4 Map	5	1182.0	RGD
RH 2.0 Map	5	1161.5	RGD
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	155	90	89	58	81	58	6	340	181	11	134	77	92	31	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC126156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027055 ⟹ ENSRNOP00000027055

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	171,833,854 - 171,838,229 (+)	Ensembl
mRatBN7.2 Ensembl	5	166,551,628 - 166,556,003 (+)	Ensembl
Rnor_6.0 Ensembl	5	173,390,901 - 173,395,276 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000133973 ⟹ ENSRNOP00000111959

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	171,833,854 - 171,838,800 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000156173 ⟹ ENSRNOP00000106163

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	171,833,854 - 171,838,229 (+)	Ensembl

RefSeq Acc Id:

NM_001108000 ⟹ NP_001101470

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,833,854 - 171,838,229 (+)	NCBI
mRatBN7.2	5	166,551,628 - 166,556,003 (+)	NCBI
Rnor_6.0	5	173,390,901 - 173,395,276 (+)	NCBI
Rnor_5.0	5	176,866,521 - 176,870,896 (+)	NCBI
RGSC_v3.4	5	172,801,076 - 172,805,451 (+)	RGD
Celera	5	164,752,352 - 164,756,727 (+)	RGD

Sequence:

show sequence

TGAGTCCTCCCCTTGGAGCCTGAGAGGCTTAGGAAGGAAGGAGGTCTCTTTTGGTGGCAGAGTT
GCCGGCAAGGGCACTGAGCAGGAGGATAGGACGGCAAAGACGAAGAGTTCTGACTCCTCCTGCA
GACATGCACCAGCGGCTGCTGGGCTCGTCCCTGGGCCTCGCCCCCGCGCAGGGGCTCTGAATGC
CTGCCGCCGCCCCCATAAGCACACTGGCCGGGGCTCCTATCCCTAAGCCTCTACTTGCGGAGAC
TGAGCCATGTGGGCTTGGGGCTGGGCTGCGGCAGCTCTCCTCTGGCTACAGACTGCAGGAGTCC
GGGCACGACAGGAACTCAAGAAGCCTCGGCAGCTGGTTGTGCGTGTGGATTCTCCCAATATTAC
CACATCCAGCCATGAGGGATTCCCAGGCTCCATCAAGCCGCCGGAAGCCTCTGGACCTGAGCTC
TCAGATGCCCACATGACATGGCTGAACTTTGTCCGACGGCCGGATGATGGGGCCTCTAGAAAAC
GGTGCCGTGGCCGGGACAAGAAGTCGCGAGGCCTCTCAGGTCTCCCAGGACCCCCAGGACCCCC
TGGCCCTCCTGGTCCACCTGGTTCCCCTGGTTTGGAAGTTACCCCAGAGGCCTTGCTGCAGGAA
TTTCAGGAGATGCTGAAAGAGGCCGCAGAACTTCGATTCTCAGGGATACCGGACTCGCTGTTAC
CCCAGGAACCCAGGCAGCGGTTGGTGGTCGAGGCCTTCCATTGCCGTTTGAAAGGCCCTGTGAC
GGTAGACAAGAAGACTCTGGTGGAACTGCAAGGATTCCAGGCTCCTACTACCCAGGGTGCCTTC
CTGCGGGGATCTGGCCTGAGCCTGTCCTTGGGCCGATTTACAGCGCCAGTCTCTGCCATCTTCC
AGTTTTCTGCCAGCCTGCACGTGGACCACAGTGAACTGCAGGGCAGAGGCCGGTTACGTACCCG
GGACACGGTCCGTGTCCTCATCTGTATTGAGTCCTTGTGTCACCGTCATACGTCCCTGGAGGCT
GTGTCAGGCCTGGAGAGCAACAGCAGGGTCTTCACCGTGCAGGTTCAGGGGCTGCTGTATTTAC
AGTCTGGACAGTATGTCTCTGTGTTCGTGGACAACAGTTCTGGGGCAGTCCTCACCATCCAGAA
CGGCTCCAGCTTCTCCGGGATGCTTTTGGGTACGTAGAGGAACTGAAGAGATGATTGAGGATTG
CAGAGCCAACACCTTGCTTCTTAGAGGAGCTGAAAAGGACTACTCCCCCTTTTAATAGTTTTCA
TAGCAATAAAGAACTCCAAACGTCTTCATCACC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101470	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL81347	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027055
	ENSRNOP00000027055.4
	ENSRNOP00000106163.1
	ENSRNOP00000111959.1

RefSeq Acc Id:	NP_001101470 ⟸ NM_001108000
- Peptide Label:	precursor
- UniProtKB:	D3ZQD2 (UniProtKB/TrEMBL), A6IUU6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MWAWGWAAAALLWLQTAGVRARQELKKPRQLVVRVDSPNITTSSHEGFPGSIKPPEASGPELSD AHMTWLNFVRRPDDGASRKRCRGRDKKSRGLSGLPGPPGPPGPPGPPGSPGLEVTPEALLQEFQ EMLKEAAELRFSGIPDSLLPQEPRQRLVVEAFHCRLKGPVTVDKKTLVELQGFQAPTTQGAFLR GSGLSLSLGRFTAPVSAIFQFSASLHVDHSELQGRGRLRTRDTVRVLICIESLCHRHTSLEAVS GLESNSRVFTVQVQGLLYLQSGQYVSVFVDNSSGAVLTIQNGSSFSGMLLGT hide sequence

Ensembl Acc Id:

ENSRNOP00000027055 ⟸ ENSRNOT00000027055

Ensembl Acc Id:

ENSRNOP00000111959 ⟸ ENSRNOT00000133973

Ensembl Acc Id:

ENSRNOP00000106163 ⟸ ENSRNOT00000156173

Protein Domains

C1q

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQD2-F1-model_v2	AlphaFold	D3ZQD2	1-308	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307059	AgrOrtholog
BioCyc Gene	G2FUF-38883	BioCyc
Ensembl Genes	ENSRNOG00000019864	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027055	ENTREZGENE
	ENSRNOT00000027055.7	UniProtKB/TrEMBL
	ENSRNOT00000133973.1	UniProtKB/TrEMBL
	ENSRNOT00000156173.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.40	UniProtKB/TrEMBL
	6-Phosphogluconate Dehydrogenase, domain 3	UniProtKB/TrEMBL
InterPro	Adipolin/Erythroferrone-rel	UniProtKB/TrEMBL
	C1q	UniProtKB/TrEMBL
	Tumour_necrosis_fac-like	UniProtKB/TrEMBL
KEGG Report	rno:313774	UniProtKB/TrEMBL
NCBI Gene	313774	ENTREZGENE
PANTHER	ADIPOLIN	UniProtKB/TrEMBL
	ADIPOLIN	UniProtKB/TrEMBL
PhenoGen	C1qtnf12	PhenoGen
PROSITE	C1Q	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019864	RatGTEx
Superfamily-SCOP	TNF_like	UniProtKB/TrEMBL
UniProt	A0ABK0L7L7_RAT	UniProtKB/TrEMBL
	A0ABK0MA44_RAT	UniProtKB/TrEMBL
	A6IUU6	ENTREZGENE, UniProtKB/TrEMBL
	D3ZQD2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-09	C1qtnf12	C1q and TNF related 12	C1qtnf12	C1q and tumor necrosis factor related protein 12	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-02-01	C1qtnf12	C1q and tumor necrosis factor related protein 12	Fam132a	family with sequence similarity 132, member A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-29	Fam132a	family with sequence similarity 132, member A	C1qdc2	C1q domain containing 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	C1qdc2	C1q domain containing 2	RGD1307059_predicted	similar to RIKEN cDNA 1110035L05 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1307059_predicted	similar to RIKEN cDNA 1110035L05 (predicted)	LOC313774_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC313774_predicted	similar to RIKEN cDNA 1110035L05 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message