Advanced Search (OLGA)

Gene: Pgls (6-phosphogluconolactonase) Rattus norvegicus

Analyze

Symbol:

Pgls

Name:

6-phosphogluconolactonase

RGD ID:

1307001

Description:

Enables 6-phosphogluconolactonase activity and monosaccharide binding activity. Involved in pentose-phosphate shunt, oxidative branch. Predicted to be located in cytoplasm. Predicted to be active in cytosol. Orthologous to human PGLS (6-phosphogluconolactonase); PARTICIPATES IN pentose phosphate pathway - oxidative phase; pentose phosphate pathway; ribose 5-phosphate isomerase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

6PGL; LOC290636

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PGLS (6-phosphogluconolactonase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pgls (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pgls (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PGLS (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PGLS (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pgls (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PGLS (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PGLS (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pgls (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pgls (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PGLS (6-phosphogluconolactonase)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pgls (6-phosphogluconolactonase)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pgls (6-phosphogluconolactonase)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17333	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SOL1	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SOL2	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SOL3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SOL4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y57G11C.3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y57G11C.3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pgls	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pgls	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	18,334,299 - 18,339,785 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	18,334,299 - 18,339,785 (+)	Ensembl				GRCr8
mRatBN7.2	16	18,300,317 - 18,305,803 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,300,317 - 18,305,803 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	18,351,215 - 18,356,701 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	19,483,253 - 19,488,771 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,404,153 - 18,409,639 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	16	18,480,082 - 18,485,600 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	16	18,353,044 - 18,358,561 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	16	18,346,982 - 18,352,499 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	16	18,492,006 - 18,497,524 (+)	NCBI		F344_StmMcwi
Rnor_6.0	16	20,020,444 - 20,025,930 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,020,444 - 20,025,930 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	19,880,872 - 19,886,358 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	18,791,241 - 18,796,727 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	18,504,223 - 18,509,709 (+)	NCBI		Celera
RGSC_v3.1	16	18,792,185 - 18,796,720 (+)	NCBI
Cytogenetic Map	16	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

osteoporosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

2-bromohexadecanoic acid (ISO)

2-butoxyethanol (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

acetamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

arsane (ISO)

arsenic atom (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (EXP,ISO)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

chlorpyrifos (EXP,ISO)

choline (ISO)

cisplatin (ISO)

clofibrate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

DDE (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP)

dioxygen (ISO)

diquat (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenthion (ISO)

folic acid (ISO)

furfural (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

hyaluronic acid (EXP)

hydrogen peroxide (EXP,ISO)

hydroquinone (ISO)

inulin (ISO)

ivermectin (ISO)

L-methionine (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methidathion (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosomorpholine (EXP)

Nutlin-3 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

SB 431542 (ISO)

sevoflurane (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sodium fluoride (ISO)

T-2 toxin (EXP,ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP,ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate metabolic process (IEA)

pentose-phosphate shunt (IEA,ISO)

pentose-phosphate shunt, oxidative branch (IBA,IDA,ISO)

Cellular Component

cytoplasm (IEA)

cytosol (IBA,IEA,ISO)

nucleoplasm (IEA,ISO)

Molecular Function

6-phosphogluconolactonase activity (IBA,IDA,IEA,ISO)

hydrolase activity (IEA)

monosaccharide binding (IDA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

pentose phosphate pathway (IEA,ISO)

pentose phosphate pathway - oxidative phase (IDA)

ribose 5-phosphate isomerase deficiency pathway (ISO)

transaldolase deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Rat liver 6-phosphogluconolactonase: a low Km enzyme.	Schofield PJ and Sols A, Biochem Biophys Res Commun. 1976 Aug 23;71(4):1313-8.

Additional References at PubMed

PMID:10518023	PMID:19056867	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Pgls
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	18,334,299 - 18,339,785 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	18,334,299 - 18,339,785 (+)	Ensembl				GRCr8
mRatBN7.2	16	18,300,317 - 18,305,803 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,300,317 - 18,305,803 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	18,351,215 - 18,356,701 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	19,483,253 - 19,488,771 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,404,153 - 18,409,639 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	16	18,480,082 - 18,485,600 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	16	18,353,044 - 18,358,561 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	16	18,346,982 - 18,352,499 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	16	18,492,006 - 18,497,524 (+)	NCBI		F344_StmMcwi
Rnor_6.0	16	20,020,444 - 20,025,930 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,020,444 - 20,025,930 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	19,880,872 - 19,886,358 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	18,791,241 - 18,796,727 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	18,504,223 - 18,509,709 (+)	NCBI		Celera
RGSC_v3.1	16	18,792,185 - 18,796,720 (+)	NCBI
Cytogenetic Map	16	p14	NCBI

PGLS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	17,511,649 - 17,521,288 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	17,511,620 - 17,521,288 (+)	Ensembl			hg38	GRCh38
GRCh37	19	17,622,458 - 17,632,097 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	17,483,432 - 17,493,097 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	17,483,431 - 17,493,095	NCBI
Celera	19	17,524,049 - 17,533,713 (+)	NCBI		Celera
Cytogenetic Map	19	p13.11	NCBI
HuRef	19	17,187,513 - 17,197,177 (+)	NCBI		HuRef
CHM1_1	19	17,621,814 - 17,631,479 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	17,646,286 - 17,655,924 (+)	NCBI		T2T-CHM13v2.0

Pgls
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	72,044,828 - 72,048,911 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	72,044,820 - 72,053,736 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	71,592,184 - 71,596,267 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	71,592,176 - 71,601,092 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	74,116,083 - 74,120,166 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	74,521,173 - 74,525,256 (+)	NCBI		MGSCv36	mm8
Celera	8	74,106,490 - 74,110,576 (+)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	34.43	NCBI

Pgls
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955524	793,239 - 801,107 (-)	Ensembl
ChiLan1.0	NW_004955524	797,439 - 801,070 (-)	NCBI	ChiLan1.0	ChiLan1.0

PGLS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	22,377,115 - 22,391,692 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	21,388,521 - 21,398,262 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	16,998,851 - 17,008,558 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	17,971,544 - 17,980,431 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	17,971,544 - 17,980,431 (+)	Ensembl			panPan2	panpan1.1

PGLS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	45,293,970 - 45,301,074 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	45,294,008 - 45,301,038 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	45,207,544 - 45,214,627 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	45,780,537 - 45,787,620 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	45,780,575 - 45,787,605 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	45,017,038 - 45,024,121 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	45,427,118 - 45,434,200 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	45,703,163 - 45,710,245 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pgls
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	203,864,866 - 203,873,259 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936596	3,413,890 - 3,422,484 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936596	3,414,003 - 3,422,467 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PGLS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	60,187,747 - 60,197,648 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	60,186,690 - 60,198,037 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	59,778,632 - 59,787,018 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PGLS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	15,997,865 - 16,006,137 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	15,997,806 - 16,006,805 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666074	3,417,737 - 3,426,225 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pgls
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624908	519,127 - 529,686 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624908	522,698 - 526,526 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pgls
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	13	13,369,016 - 13,373,593 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pgls
45 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	108
Count of miRNA genes:	95
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000024827
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549842	Bp248	Blood pressure QTL 248		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	387123	45387123	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33425095	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39568015	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4234212	53708481	Rat
631517	Scl9	Serum cholesterol level QTL 9	3.3		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	16	15748006	25801629	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	4744222	49744222	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	1	26734272	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26734272	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	4354822	49354822	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	387123	45387123	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4234212	49757901	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4234212	66955197	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	16278184	27244292	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39568015	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	839086	66195506	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3386790	49757901	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3386790	26128267	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	839086	66195506	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	839086	66195506	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26734272	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17730818	72536785	Rat
2301406	Kidm39	Kidney mass QTL 39		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	15905802	60905802	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	839086	52786090	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	839086	66195506	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	3301683	48301683	Rat

Markers in Region

BE099440

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	16	18,334,862 - 18,335,020 (+)	Marker Load Pipeline
mRatBN7.2	16	18,300,880 - 18,301,038 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,021,008 - 20,021,165	NCBI	Rnor6.0
Rnor_5.0	16	19,881,436 - 19,881,593	UniSTS	Rnor5.0
RGSC_v3.4	16	18,791,805 - 18,791,962	UniSTS	RGSC3.4
Celera	16	18,504,787 - 18,504,944	UniSTS
RH 3.4 Map	16	191.3	UniSTS
Cytogenetic Map	16	p14	UniSTS

RH131434

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	16	18,338,157 - 18,338,694 (+)	Marker Load Pipeline
mRatBN7.2	16	18,304,175 - 18,304,712 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,024,303 - 20,024,839	NCBI	Rnor6.0
Rnor_5.0	16	19,884,731 - 19,885,267	UniSTS	Rnor5.0
RGSC_v3.4	16	18,795,100 - 18,795,636	UniSTS	RGSC3.4
Celera	16	18,508,082 - 18,508,618	UniSTS
RH 3.4 Map	16	194.2	UniSTS
Cytogenetic Map	16	p14	UniSTS

RH132813

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	18,302,838 - 18,303,042 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,022,966 - 20,023,169	NCBI	Rnor6.0
Rnor_5.0	16	19,883,394 - 19,883,597	UniSTS	Rnor5.0
RGSC_v3.4	16	18,793,763 - 18,793,966	UniSTS	RGSC3.4
Celera	16	18,506,745 - 18,506,948	UniSTS
Cytogenetic Map	16	p14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
28	14	93	228	91	90	59	182	59	6	542	319	24	213	128	130	31	39	39

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC122603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024827 ⟹ ENSRNOP00000024827

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	18,334,299 - 18,339,785 (+)	Ensembl
mRatBN7.2 Ensembl	16	18,300,317 - 18,305,803 (+)	Ensembl
Rnor_6.0 Ensembl	16	20,020,444 - 20,025,930 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097675 ⟹ ENSRNOP00000080138

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	18,336,306 - 18,339,785 (+)	Ensembl
mRatBN7.2 Ensembl	16	18,302,324 - 18,305,803 (+)	Ensembl

RefSeq Acc Id:

NM_001106066 ⟹ NP_001099536

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,334,299 - 18,339,785 (+)	NCBI
mRatBN7.2	16	18,300,317 - 18,305,803 (+)	NCBI
Dahl_SR_JrHsd	16	18,480,082 - 18,485,600 (+)	NCBI
Lyon_Normotensive	16	18,353,044 - 18,358,561 (+)	NCBI
Lyon_Hypertensive	16	18,346,982 - 18,352,499 (+)	NCBI
F344_StmMcwi	16	18,492,006 - 18,497,524 (+)	NCBI
Rnor_6.0	16	20,020,444 - 20,025,930 (+)	NCBI
Rnor_5.0	16	19,880,872 - 19,886,358 (+)	NCBI
RGSC_v3.4	16	18,791,241 - 18,796,727 (+)	RGD
Celera	16	18,504,223 - 18,509,709 (+)	RGD

Sequence:

show sequence

GGCCTGAATGGGGGCACAAGCCTTTAATCCCAGCATTTGGGAAGCAGAAGCAGGCAGGTCTTTG
TTTGAGGCCAGCCTACTCTACAGAGTGACTTCCAGAACAACCAGGGCCACAACAACAACAGTCA
CTCTTAAACAACAACAAAGTTCTTGCAGTGTTTCACAGTGTATAACTTGCTACTTGAAGCCATC
CATGGGCACTCAAGGCTGTAGGTTTGGGATTAGGGTGCAGCCAATGATCCAGCCTGGACTTAGC
ATTCAGCAGGCCCTGGATTTAGTCCCAGCACAGTGACCGACTGCATTTTGGAGCTCTCCTGAGT
TCGGGAGGGTGACACATTATCAGTCGTCTTTTGGGTGCAATGGCTCAGTGGTTAAGAGTACTCG
TTGGGCTTGCTTCCTTCCTTCCTTCCATGCAACGATCTAACTCAGACCCAGGGTCTCCTGGACT
CTGCACACACTTGGCACAGAGATACTCATGCGGGAGAAACAGCCATGCTCATTGAAAAAAAATA
AATTAAGCAAAAATAAAGGAGTAAATTAAGAGAGAGGAACCAGAGGGGGTTTATTTGGGTCTTC
ATGGTGGAAGCAGCTGTCTGTCACCTTCTCACTGATCTACTTGGGTCAAGGCTCTTAACAGTCC
CAAAGTTTCCGTATGTGGGCCACTGGGAGCCACCTGTTGAAGCACATGAATGGGGGCAGTTTCA
CACCCAAATGCAGATGTTTTCAACTGTTGGGCAGCAGTTGTCCCGGGGAGTCCTCTTTCTGCTG
TGGGCAGCTGTGAGCGGAAGGCAGCGGAGTGTCACTGCATCCGCTTTCGTAACACAAAAAAAGG
GGTGTCGGGGGGTTGGGGATTTGGCTCAGTGGTAGAGTGCTTGCCTAGCATGCGCAAGGCCCTG
GGTTCGGTCCCCAGCTCCGAAAAAAAAAAAAAAAGGGGTGTCGGGATAGGCGAATGTGGGGAGG
GCCGTGCAGGCACAGGGACATCATAAGTGTGTGTGTATGACAAGAGTCCCACTGCTTAGCCCAA
TCTGGCCTCTAACTCGGGCTAGCCGCCTGCCTTTGCCACCTGAGGGCTAGCATGAGTGTAGGTC
ATCACGCCTGGCTTATTGACCTTATCACACTGCAGCTGGCGCACTCTGTGTGTCCAACCGCACC
CCGGAAACCCGCTACACCCTCAAGAGTGCAGGTGCATTCAGGTCACCTCAGCCCTCAAGTCGAG
GAAGGACGATCAGGAGCGTGAAGCCAGCCGGAGCTACATGACTCCGTCTTAAAAAACTAAATAA
AATGCGAGAAATCGGTCCAGGAAGGCGTCCCCAGTTCAGGGAAGCACTGTGGATTGCCCGCCCA
CCACCCACCCCAAAACCCTGAGGCGCACTGTGGCTTCGCTTCATCTGCGCAACTGCACATGCGC
CTATGGCCTTGGCTCAAAGTGCTCGGACCCATGGCAGCTCGGCCGTCGCGCAGGCGCACTGGCG
TACTGGCCTCTGCCCGGAGCGCTGTCGCCTCCCCGCCGCCATGGCCGCACCCGCGCCCGGTCTC
ATCTCGGTCTTCTCCAGCCCACAGGAGCTGGGCGCATCGCTGGCGCAGCTGGTGGCGCAGCGGG
CCGCTAGCTGCTTGGAAGGGAACCGTGGCCGCTTCGCTCTTGGCCTGTCAGGCGGCAGCCTGGT
CTCCATGCTGGCCCGAGACCTACCCGCCGCCACTGCTCCCGCGGGGCCCGCCAGCTTTGCACGC
TGGACGCTCGGCTTCTGTGACGAGCGCCTCGTGCCCTTCGACCACGCCGAAAGCACGTACGGCC
TCTACCGGACACACCTGCTCTCAAAGCTGCCCATCCCAGACAGCCAGGTCCTCACCATCGATCC
CGCCCTACCTGTGGAGGACGCTGCAGAGGACTATGCCAGGAAACTGAGGCAGGCCTTCCAAGGA
GACACTGTCCCTGTGTTTGACCTGCTGATCCTGGGAGTGGGCCCTGACGGCCACACCTGTTCGC
TCTTCCCTGGGCATCCCCTCCTCCAGGAGCGGGAGAAGATCGTGGCTCCCATTGGTGACTCCCC
AAAGCCACCACCGCAGAGGGTGACCCTTACACTCCCTGTGCTGAACGCAGCCCAAAGTGTCATA
TTCGTGGCCACAGGGGAAGGCAAGGCAGCTGTGCTGAAGCGCATCCTGGAGGACCAGGAGAGCG
CGCTGCCCGCCGCCATGGTGCAGCCGCGCACGGGCGCCCTCTGCTGGTTCCTGGACGAGGCAGC
TGCACGGCTGCTGTCTGTGCCCTTCGAGAAGCATTCCACGTTATAGGGGCCGCACCACGCACGC
TGTGGGCACTTCGGGCCGCAGAGACTACGGGAGAGGACTACCTGCAGATTAAACAGCTTTGCTG
GAACTCTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099536	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL90770	(Get FASTA)	NCBI Sequence Viewer
	EDL90771	(Get FASTA)	NCBI Sequence Viewer
	EDL90772	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024827
GenBank Protein	P85971	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001099536 ⟸ NM_001106066

- UniProtKB:

P85971 (UniProtKB/Swiss-Prot), G3V8D5 (UniProtKB/TrEMBL), A6K9W6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALAQSARTHGSSAVAQAHWRTGLCPERCRLPAAMAAPAPGLISVFSSPQELGASLAQLVAQRA
ASCLEGNRGRFALGLSGGSLVSMLARDLPAATAPAGPASFARWTLGFCDERLVPFDHAESTYGL
YRTHLLSKLPIPDSQVLTIDPALPVEDAAEDYARKLRQAFQGDTVPVFDLLILGVGPDGHTCSL
FPGHPLLQEREKIVAPIGDSPKPPPQRVTLTLPVLNAAQSVIFVATGEGKAAVLKRILEDQESA
LPAAMVQPRTGALCWFLDEAAARLLSVPFEKHSTL

hide sequence

Ensembl Acc Id:

ENSRNOP00000024827 ⟸ ENSRNOT00000024827

Ensembl Acc Id:

ENSRNOP00000080138 ⟸ ENSRNOT00000097675

Protein Domains

Glucosamine/galactosamine-6-phosphate isomerase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P85971-F1-model_v2	AlphaFold	P85971	1-257	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307001	AgrOrtholog
BioCyc Gene	G2FUF-11837	BioCyc
BioCyc Pathway	OXIDATIVEPENT-PWY [pentose phosphate pathway (oxidative branch) I]	BioCyc
BioCyc Pathway Image	OXIDATIVEPENT-PWY	BioCyc
Ensembl Genes	ENSRNOG00000018326	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000024827	ENTREZGENE
Gene3D-CATH	3.40.50.1360	UniProtKB/Swiss-Prot
InterPro	6-phosphogluconolactonase_DevB	UniProtKB/Swiss-Prot
	Glc/Gal-6P_isomerase	UniProtKB/Swiss-Prot
	NagB/RpiA_transferase-like	UniProtKB/Swiss-Prot
	PGLS	UniProtKB/Swiss-Prot
NCBI Gene	290636	ENTREZGENE
PANTHER	6-PHOSPHOGLUCONOLACTONASE	UniProtKB/Swiss-Prot
	PTHR11054	UniProtKB/Swiss-Prot
Pfam	Glucosamine_iso	UniProtKB/Swiss-Prot
PhenoGen	Pgls	PhenoGen
RatGTEx	ENSRNOG00000018326	RatGTEx
Superfamily-SCOP	SSF100950	UniProtKB/Swiss-Prot
UniProt	6PGL_RAT	UniProtKB/Swiss-Prot
	A0A8I5ZPY3_RAT	UniProtKB/TrEMBL
	A6K9W6	ENTREZGENE, UniProtKB/TrEMBL
	G3V8D5	ENTREZGENE, UniProtKB/TrEMBL
	P85971	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Pgls	6-phosphogluconolactonase	Pgls_predicted	6-phosphogluconolactonase (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Pgls_predicted	6-phosphogluconolactonase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways