Advanced Search (OLGA)

Gene: Fitm1 (fat storage-inducing transmembrane protein 1) Rattus norvegicus

Analyze

Symbol:

Fitm1

Name:

fat storage-inducing transmembrane protein 1

RGD ID:

1306911

Description:

Predicted to enable diacylglycerol binding activity and triglyceride binding activity. Predicted to be involved in fat cell differentiation; lipid droplet formation; and phospholipid biosynthetic process. Predicted to be active in endoplasmic reticulum membrane. Orthologous to human FITM1 (fat storage inducing transmembrane protein 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

fat-inducing transcript 1; Fit1; LOC290223; RGD1306911; similar to CG10671-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,034,705 - 33,035,974 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	33,034,688 - 33,035,974 (+)	Ensembl				GRCr8
mRatBN7.2	15	29,064,746 - 29,066,015 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,064,707 - 29,066,015 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	30,910,449 - 30,911,718 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,057,655 - 32,058,924 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,300,002 - 30,301,271 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	15	31,733,979 - 31,735,248 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	15	31,438,723 - 31,439,992 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	15	31,545,209 - 31,546,478 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	15	30,731,799 - 30,733,068 (+)	NCBI		F344_StmMcwi
Rnor_6.0	15	34,251,805 - 34,253,074 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,251,606 - 34,253,073 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	38,142,000 - 38,143,269 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	33,708,626 - 33,709,895 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	28,640,667 - 28,641,936 (+)	NCBI		Celera
RGSC_v3.1	15	33,723,380 - 33,725,595 (+)	NCBI
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

1,4-dioxane (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

clothianidin (ISO)

Cuprizon (EXP)

dibenzofurans (ISO)

dichloroacetic acid (ISO)

diquat (ISO)

doxorubicin (ISO)

fenthion (ISO)

genistein (ISO)

gentamycin (EXP)

inulin (ISO)

Licochalcone B (ISO)

lidocaine (EXP)

N-nitrosodiethylamine (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

pirinixic acid (ISO)

quercetin (ISO)

Soman (EXP)

sunitinib (ISO)

tetrachloromethane (ISO)

trichloroethene (EXP,ISO)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

fat cell differentiation (IEA,ISO)

lipid droplet formation (IEA,ISO)

lipid droplet organization (IBA,IEA,ISO)

lipid storage (IBA,IEA)

phospholipid biosynthetic process (IBA,IEA)

Cellular Component

endoplasmic reticulum membrane (IBA,IEA,ISO)

Molecular Function

coenzyme A diphosphatase activity (IEA)

diacylglycerol binding (IEA,ISO)

triglyceride binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18160536	PMID:20520733

Genomics

Comparative Map Data

Fitm1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,034,705 - 33,035,974 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	33,034,688 - 33,035,974 (+)	Ensembl				GRCr8
mRatBN7.2	15	29,064,746 - 29,066,015 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,064,707 - 29,066,015 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	30,910,449 - 30,911,718 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,057,655 - 32,058,924 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,300,002 - 30,301,271 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	15	31,733,979 - 31,735,248 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	15	31,438,723 - 31,439,992 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	15	31,545,209 - 31,546,478 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	15	30,731,799 - 30,733,068 (+)	NCBI		F344_StmMcwi
Rnor_6.0	15	34,251,805 - 34,253,074 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,251,606 - 34,253,073 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	38,142,000 - 38,143,269 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	33,708,626 - 33,709,895 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	28,640,667 - 28,641,936 (+)	NCBI		Celera
RGSC_v3.1	15	33,723,380 - 33,725,595 (+)	NCBI
Cytogenetic Map	15	p13	NCBI

FITM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,130,659 - 24,132,847 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	24,130,659 - 24,132,849 (+)	Ensembl			hg38	GRCh38
GRCh37	14	24,599,868 - 24,602,056 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	23,670,608 - 23,671,898 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	14	4,465,145 - 4,466,528 (+)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	4,715,896 - 4,717,279 (+)	NCBI		HuRef
CHM1_1	14	24,599,346 - 24,600,729 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,328,966 - 18,331,154 (+)	NCBI		T2T-CHM13v2.0

Fitm1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	55,813,131 - 55,814,409 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	55,813,074 - 55,814,411 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	55,575,674 - 55,576,952 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	55,575,617 - 55,576,954 (+)	Ensembl			mm10	GRCm38
MGSCv37	14	56,194,511 - 56,195,789 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	54,529,745 - 54,531,023 (+)	NCBI		MGSCv36	mm8
Celera	14	53,380,530 - 53,381,808 (+)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.19	NCBI

Fitm1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	36,267,121 - 36,268,462 (-)	Ensembl
ChiLan1.0	NW_004955409	36,267,121 - 36,268,462 (-)	NCBI	ChiLan1.0	ChiLan1.0

FITM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	25,485,044 - 25,488,412 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	24,701,536 - 24,704,903 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	4,906,504 - 4,909,119 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	23,031,818 - 23,033,459 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	23,031,818 - 23,033,459 (+)	Ensembl			panPan2	panpan1.1

FITM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	4,127,148 - 4,128,779 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	4,127,488 - 4,128,794 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	4,048,851 - 4,050,451 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	4,237,758 - 4,239,358 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	4,238,067 - 4,239,333 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	3,928,387 - 3,929,987 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	3,990,136 - 3,991,736 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	4,252,301 - 4,253,901 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fitm1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	35,974,305 - 35,978,696 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936722	410,294 - 411,679 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936722	410,294 - 411,680 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FITM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	75,166,912 - 75,168,245 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	75,166,986 - 75,168,240 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	80,438,281 - 80,439,536 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FITM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	1,116,201 - 1,118,814 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	1,117,451 - 1,119,275 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666036	12,797,952 - 12,800,552 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fitm1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	8,402,347 - 8,403,663 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624820	8,402,347 - 8,407,399 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fitm1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	69,432,855 - 69,434,127 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fitm1
14 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	38
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000025725
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	31855803	92671517	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	22728353	42072050	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	28527732	73527732	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	22336351	52597086	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	19155762	87086765	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	22336351	67336351	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat

Markers in Region

RH131757

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,065,816 - 29,065,996 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,252,876 - 34,253,055	NCBI	Rnor6.0
Rnor_5.0	15	38,143,071 - 38,143,250	UniSTS	Rnor5.0
RGSC_v3.4	15	33,709,697 - 33,709,876	UniSTS	RGSC3.4
Celera	15	28,641,738 - 28,641,917	UniSTS
Cytogenetic Map	15	p13	UniSTS

Cg10671-pending

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,064,824 - 29,065,985 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,251,884 - 34,253,044	NCBI	Rnor6.0
Rnor_5.0	15	38,142,079 - 38,143,239	UniSTS	Rnor5.0
RGSC_v3.4	15	33,708,705 - 33,709,865	UniSTS	RGSC3.4
Celera	15	28,640,746 - 28,641,906	UniSTS
Cytogenetic Map	15	p13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	12	66	112	67	66	35	67	35	6	302	166	10	84	79	84	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025725 ⟹ ENSRNOP00000025725

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	33,034,688 - 33,035,974 (+)	Ensembl
mRatBN7.2 Ensembl	15	29,064,707 - 29,066,015 (+)	Ensembl
Rnor_6.0 Ensembl	15	34,251,606 - 34,253,073 (+)	Ensembl

RefSeq Acc Id:

NM_001106037 ⟹ NP_001099507

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,034,705 - 33,035,974 (+)	NCBI
mRatBN7.2	15	29,064,746 - 29,066,015 (+)	NCBI
Dahl_SR_JrHsd	15	31,733,979 - 31,735,248 (+)	NCBI
Lyon_Normotensive	15	31,438,723 - 31,439,992 (+)	NCBI
Lyon_Hypertensive	15	31,545,209 - 31,546,478 (+)	NCBI
F344_StmMcwi	15	30,731,799 - 30,733,068 (+)	NCBI
Rnor_6.0	15	34,251,805 - 34,253,074 (+)	NCBI
Rnor_5.0	15	38,142,000 - 38,143,269 (+)	NCBI
RGSC_v3.4	15	33,708,626 - 33,709,895 (+)	RGD
Celera	15	28,640,667 - 28,641,936 (+)	RGD

Sequence:

show sequence

GGGAGGGGAGGGAACATGGAGCGGGGGCCGATGGTGGGGGCAGGGCCGGGGGCCGGGACCCGAG
TCCGAGCACTGTTGGGATGCCTGGTCAAGGTGGTGCTCTGGGTGGCCTCTGCCTTACTGTACTT
TGGAAGTGAACAAGCCGCCCGCCTCCTAGGCAGCCCTTGCTTACGGCGCCTCTACCATGCTTGG
TTGGCAGCAGTGGTCATCTTTGGGCCCCTTCTGCAGTTTCACGTTAACTCTCGGACGATCTTCG
CTAGCCACGGCAACTTCTTCAACATAAAGTTTGTGAATTCAGCGTGGGGCTGGACATGCACCTT
CCTGGGGGGCTTTGTGCTCCTGGTGGTGTTCCTGGCTACTCGACGTGTAGCAGTGACTGCCCGG
CACCTGAGCCGACTGGTGGTGGGGGCAGCTGTATGGCGGGGGGCCGGACGAGCCTTCCTACTCA
TCGAGGACCTGACCGGTTCCTGCTTTGAGCCTCTGCCCCAGGGCCTACTGCTGCATGAGCTGCC
TGACCGCAAGAGTTGCCTGGCAGCCGGCCACCAGTGGCGGGGTTACACTGTCTCCTCCCACACC
TTCCTCCTTACCTTCTGCTGCCTTCTCATGGCTGAGGAAGCAGCTGTGTTTGCCAAGTACCTGG
CCCATGGGCTACCAGCTGGCGCCCCACTGCGTCTTGTTTTTCTACTCAATGTGCTGCTGCTCGG
CCTCTGGAACTTCCTGCTACTCTGCACAGTCATCTATTTCCATCAATATACCCACAAGGTGGTG
GGTGCGGCAGTAGGCACGTTTGCTTGGTACCTTACCTATGGCAGCTGGTACCATCAGCCCTGGT
CCCCTGGGATCCCAGGCCACGGGCTCTTCCCTCGATCCCGCTCAATCCGCAAACATAACTGAAA
GAAATAAAAAGCATACCAGGCCTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099507	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14240	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025725
	ENSRNOP00000025725.4

RefSeq Acc Id:

NP_001099507 ⟸ NM_001106037

- UniProtKB:

D3ZIQ3 (UniProtKB/TrEMBL), A6KH11 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERGPMVGAGPGAGTRVRALLGCLVKVVLWVASALLYFGSEQAARLLGSPCLRRLYHAWLAAVV
IFGPLLQFHVNSRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAVTARHLSRL
VVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRKSCLAAGHQWRGYTVSSHTFLLTF
CCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTVIYFHQYTHKVVGAAVG
TFAWYLTYGSWYHQPWSPGIPGHGLFPRSRSIRKHN

hide sequence

Ensembl Acc Id:

ENSRNOP00000025725 ⟸ ENSRNOT00000025725

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZIQ3-F1-model_v2	AlphaFold	D3ZIQ3	1-292	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699671

Promoter ID:

EPDNEW_R10194

Type:

multiple initiation site

Name:

Fitm1_1

Description:

fat storage-inducing transmembrane protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	34,251,767 - 34,251,827	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306911	AgrOrtholog
BioCyc Gene	G2FUF-13713	BioCyc
Ensembl Genes	ENSRNOG00000019019	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025725	ENTREZGENE
	ENSRNOT00000025725.8	UniProtKB/TrEMBL
InterPro	FIT1	UniProtKB/TrEMBL
	FIT1	UniProtKB/TrEMBL
	FITM1/2	UniProtKB/TrEMBL
KEGG Report	rno:290223	UniProtKB/TrEMBL
NCBI Gene	290223	ENTREZGENE
PANTHER	FAT STORAGE-INDUCING TRANSMEMBRANE PROTEIN 1	UniProtKB/TrEMBL
	PTHR23129	UniProtKB/TrEMBL
PhenoGen	Fitm1	PhenoGen
RatGTEx	ENSRNOG00000019019	RatGTEx
UniProt	A6KH11	ENTREZGENE, UniProtKB/TrEMBL
	D3ZIQ3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-05-22	Fitm1	fat storage-inducing transmembrane protein 1	Fit1	fat-inducing transcript 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-11	Fit1	fat-inducing transcript 1	RGD1306911_predicted	similar to CG10671-like (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1306911_predicted	similar to CG10671-like (predicted)	LOC290223_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC290223_predicted	similar to CG10671-like (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message