Advanced Search (OLGA)

Gene: Smim23 (small integral membrane protein 23) Rattus norvegicus

Analyze

Symbol:

Smim23

Name:

small integral membrane protein 23

RGD ID:

1306625

Description:

Orthologous to human SMIM23 (small integral membrane protein 23); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC360508; LOC360508; RGD1306625; uncharacterized protein LOC360508

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	17,907,716 - 17,911,350 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	17,907,716 - 17,911,895 (-)	Ensembl				GRCr8
mRatBN7.2	10	17,403,456 - 17,407,091 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	17,403,456 - 17,407,168 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	22,152,365 - 22,155,864 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	21,640,953 - 21,644,452 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	17,129,211 - 17,132,845 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	17,717,599 - 17,721,233 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	17,717,599 - 17,721,233 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	17,605,598 - 17,609,232 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	17,687,792 - 17,691,426 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	17,047,052 - 17,050,557 (-)	NCBI		Celera
RGSC_v3.1	10	17,688,839 - 17,692,414 (-)	NCBI
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

acrylamide (EXP)

bisphenol A (EXP)

cadmium dichloride (EXP)

decabromodiphenyl ether (EXP)

paracetamol (ISO)

Theaflavin 3,3'-digallate (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Smim23
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	17,907,716 - 17,911,350 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	17,907,716 - 17,911,895 (-)	Ensembl				GRCr8
mRatBN7.2	10	17,403,456 - 17,407,091 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	17,403,456 - 17,407,168 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	22,152,365 - 22,155,864 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	21,640,953 - 21,644,452 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	17,129,211 - 17,132,845 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	17,717,599 - 17,721,233 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	17,717,599 - 17,721,233 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	17,605,598 - 17,609,232 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	17,687,792 - 17,691,426 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	17,047,052 - 17,050,557 (-)	NCBI		Celera
RGSC_v3.1	10	17,688,839 - 17,692,414 (-)	NCBI
Cytogenetic Map	10	q12	NCBI

SMIM23
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	171,772,637 - 171,791,136 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	171,782,432 - 171,796,126 (+)	Ensembl			hg38	GRCh38
GRCh37	5	171,212,821 - 171,218,140 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	171,145,481 - 171,166,221 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	5	167,162,218 - 167,266,076 (+)	NCBI		Celera
Cytogenetic Map	5	q35.1	NCBI
HuRef	5	166,309,194 - 166,314,503 (+)	NCBI		HuRef
CHM1_1	5	170,645,301 - 170,650,600 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	172,312,952 - 172,331,444 (+)	NCBI		T2T-CHM13v2.0

Smim23
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	32,770,376 - 32,774,594 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	32,768,529 - 32,774,605 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	32,820,376 - 32,824,594 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	32,818,529 - 32,824,605 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	32,720,376 - 32,724,594 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	32,718,529 - 32,724,573 (-)	NCBI		MGSCv36	mm8
Celera	11	35,239,451 - 35,243,685 (-)	NCBI		Celera
Cytogenetic Map	11	A4	NCBI
cM Map	11	19.11	NCBI

Smim23
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	24,626,470 - 24,635,327 (+)	Ensembl
ChiLan1.0	NW_004955408	24,626,468 - 24,633,678 (+)	NCBI	ChiLan1.0	ChiLan1.0

SMIM23
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	166,920,229 - 166,927,164 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	165,059,779 - 165,066,703 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	167,131,772 - 167,137,236 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	174,048,837 - 174,054,098 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	174,048,837 - 174,057,589 (+)	Ensembl			panPan2	panpan1.1

SMIM23
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	40,427,841 - 40,434,357 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	40,428,036 - 40,434,359 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	40,376,734 - 40,383,249 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	40,803,162 - 40,809,683 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	40,803,357 - 40,809,588 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	40,618,344 - 40,624,858 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	40,808,669 - 40,815,178 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	41,318,857 - 41,325,364 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Smim23
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	94,676,110 - 94,683,159 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936609	3,398,891 - 3,405,769 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936609	3,398,891 - 3,405,769 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SMIM23
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	52,404,004 - 52,412,792 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	52,404,463 - 52,412,731 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SMIM23
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	73,941,701 - 73,947,307 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666034	4,693,539 - 4,698,888 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Smim23
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	18,193,037 - 18,196,932 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624733	18,193,286 - 18,196,848 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Smim23
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	5,650,162 - 5,653,548 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Smim23
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	66
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000031337
Prediction methods:	Microtar, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6661118	35509383	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35730538	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	30004247	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
737823	Alc12	Alcohol consumption QTL 12	4.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	17749784	20796344	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	15762230	19737486	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	6	6	35	34	30	16	12	16	5	68	34	22	7	27	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031337 ⟹ ENSRNOP00000038766

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	17,907,716 - 17,911,895 (-)	Ensembl
mRatBN7.2 Ensembl	10	17,403,456 - 17,407,168 (-)	Ensembl
Rnor_6.0 Ensembl	10	17,717,599 - 17,721,233 (-)	Ensembl

RefSeq Acc Id:

NM_001108271 ⟹ NP_001101741

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	17,907,716 - 17,911,350 (-)	NCBI
mRatBN7.2	10	17,403,456 - 17,407,091 (-)	NCBI
Rnor_6.0	10	17,717,599 - 17,721,233 (-)	NCBI
Rnor_5.0	10	17,605,598 - 17,609,232 (-)	NCBI
RGSC_v3.4	10	17,687,792 - 17,691,426 (-)	RGD
Celera	10	17,047,052 - 17,050,557 (-)	RGD

Sequence:

show sequence

CTGCCTGTCCACTGAAAGTACTTCCATCCACCCCAACAAGCCTTTGACCCTAAGCAGAGACATG
ACGATCCAGAAGACGGGTGGCAGAGGCCGGGCAGCAGCTGAGCTACTTGAACAGAGAAGGAGCA
GCCACCACTGTGATGACAGGAAGCAGACGCTGTTAGCACTGCTCGTCCTGGTGCTGTACCTGGG
CACAGGGATATCAGGAAGCAGTTGGGAAGTGTCAGGACGAACCAAGGACTGCAACCACTTTCAG
ACGACTGTAACATCCCAGGACTTTGAATATCAGACCAAGGAACCTGCTGAAGAGCCATTGAGGG
CCCTCAGGAAGTGGCTGAAGACAAACTTGCACGGGTTTTTGGAGAAGCTAGAGAAAGAGGTCAG
AGAGCTGGAGCAGCTGGTGCGGGACCTGGAATTCTGGCTCGATGCGCTTCTGGGAGAGCCACAC
TCAGAGGATCCCTGCTTTACCACAAAGGTCATTTGTGAAGGGCAGGTGCAGGGACCCGGGGAGC
AGAAGAGGAGGTGATGAGGTCAGGCCCTGACACTCGCTGCTCCAGGCAGGCTGGAGAAAAATAA
AGTGACCGAGAGGTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101741	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM04064	(Get FASTA)	NCBI Sequence Viewer
	EDM04065	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038766
	ENSRNOP00000038766.6

RefSeq Acc Id:	NP_001101741 ⟸ NM_001108271
- UniProtKB:	D4A0X0 (UniProtKB/TrEMBL), A6HDG0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTIQKTGGRGRAAAELLEQRRSSHHCDDRKQTLLALLVLVLYLGTGISGSSWEVSGRTKDCNHF QTTVTSQDFEYQTKEPAEEPLRALRKWLKTNLHGFLEKLEKEVRELEQLVRDLEFWLDALLGEP HSEDPCFTTKVICEGQVQGPGEQKRR hide sequence

Ensembl Acc Id:

ENSRNOP00000038766 ⟸ ENSRNOT00000031337

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A0X0-F1-model_v2	AlphaFold	D4A0X0	1-154	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697093

Promoter ID:

EPDNEW_R7618

Type:

initiation region

Name:

Smim23_1

Description:

small integral membrane protein 23

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	17,721,239 - 17,721,299	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306625	AgrOrtholog
BioCyc Gene	G2FUF-25617	BioCyc
Ensembl Genes	ENSRNOG00000027196	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000031337	ENTREZGENE
	ENSRNOT00000031337.6	UniProtKB/TrEMBL
InterPro	DUF4635	UniProtKB/TrEMBL
KEGG Report	rno:360508	UniProtKB/TrEMBL
NCBI Gene	360508	ENTREZGENE
PANTHER	PTHR37865	UniProtKB/TrEMBL
	SMALL INTEGRAL MEMBRANE PROTEIN 23	UniProtKB/TrEMBL
Pfam	DUF4635	UniProtKB/TrEMBL
PhenoGen	Smim23	PhenoGen
RatGTEx	ENSRNOG00000027196	RatGTEx
UniProt	A6HDG0	ENTREZGENE, UniProtKB/TrEMBL
	D4A0X0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-02-13	Smim23	small integral membrane protein 23	RGD1306625	LOC360508	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1306625	LOC360508	RGD1306625_predicted	LOC360508 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1306625_predicted	LOC360508 (predicted)	LOC360508_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC360508_predicted	LOC360508 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message