Advanced Search (OLGA)

Gene: Spic (Spi-C transcription factor) Rattus norvegicus

Analyze

Symbol:

Spic

Name:

Spi-C transcription factor

RGD ID:

1306272

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in cell differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within blastocyst development and positive regulation of transcription by RNA polymerase II. Predicted to be active in nucleus. Orthologous to human SPIC (Spi-C transcription factor); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; acetamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC314711; Spi-C transcription factor (Spi-1/PU.1 related); transcription factor Spi-C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SPIC (Spi-C transcription factor)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Spic (Spi-C transcription factor (Spi-1/PU.1 related))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Spic (Spi-C transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SPIC (Spi-C transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SPIC (Spi-C transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Spic (Spi-C transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SPIC (Spi-C transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SPIC (Spi-C transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Spic (Spi-C transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Spic (Spi-C transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SPIC (Spi-C transcription factor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Spic (Spi-C transcription factor (Spi-1/PU.1 related))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	spic (Spi-C transcription factor (Spi-1/PU.1 related))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	spic (Spi-C transcription factor (Spi-1/PU.1 related))	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	spi2 (Spi-2 proto-oncogene)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	spic	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	24,957,213 - 24,964,918 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	24,957,219 - 24,964,900 (-)	Ensembl				GRCr8
mRatBN7.2	7	23,069,815 - 23,077,517 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	23,069,821 - 23,077,548 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	25,064,374 - 25,072,061 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	27,227,072 - 27,234,765 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	27,004,124 - 27,011,811 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	29,225,721 - 29,233,452 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	29,225,727 - 29,233,392 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	29,331,304 - 29,339,005 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	25,354,400 - 25,362,070 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	20,229,536 - 20,237,196 (-)	NCBI		Celera
RGSC_v3.1	7	25,375,040 - 25,384,163 (-)	NCBI
Cytogenetic Map	7	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

bisphenol A (EXP,ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

epoxiconazole (ISO)

folic acid (ISO)

formaldehyde (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

methyl methanesulfonate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

oxaliplatin (EXP)

paracetamol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

pravastatin (EXP,ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

tacrolimus hydrate (ISO)

titanium dioxide (ISO)

topotecan (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blastocyst development (ISO)

cell differentiation (IBA)

DNA-templated transcription (IEA)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (IBA,IEA)

Cellular Component

nucleus (IBA,IEA)

Molecular Function

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO)

sequence-specific DNA binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12749910	PMID:16630543

Genomics

Comparative Map Data

Spic
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	24,957,213 - 24,964,918 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	24,957,219 - 24,964,900 (-)	Ensembl				GRCr8
mRatBN7.2	7	23,069,815 - 23,077,517 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	23,069,821 - 23,077,548 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	25,064,374 - 25,072,061 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	27,227,072 - 27,234,765 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	27,004,124 - 27,011,811 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	29,225,721 - 29,233,452 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	29,225,727 - 29,233,392 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	29,331,304 - 29,339,005 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	25,354,400 - 25,362,070 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	20,229,536 - 20,237,196 (-)	NCBI		Celera
RGSC_v3.1	7	25,375,040 - 25,384,163 (-)	NCBI
Cytogenetic Map	7	q13	NCBI

SPIC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	101,475,336 - 101,486,997 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	101,475,336 - 101,486,997 (+)	Ensembl			hg38	GRCh38
GRCh37	12	101,869,114 - 101,880,775 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	100,394,788 - 100,404,906 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	100,373,124 - 100,383,242	NCBI
Celera	12	101,535,714 - 101,545,426 (+)	NCBI		Celera
Cytogenetic Map	12	q23.2	NCBI
HuRef	12	98,930,755 - 98,940,945 (+)	NCBI		HuRef
CHM1_1	12	101,836,565 - 101,847,522 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	101,436,475 - 101,448,154 (+)	NCBI		T2T-CHM13v2.0

Spic
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	88,511,131 - 88,518,885 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	88,510,634 - 88,520,877 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	88,675,269 - 88,683,023 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	88,674,772 - 88,685,015 (-)	Ensembl			mm10	GRCm38
MGSCv37	10	88,138,014 - 88,145,768 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	88,105,076 - 88,112,821 (-)	NCBI		MGSCv36	mm8
Celera	10	90,655,323 - 90,663,281 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	44.14	NCBI

Spic
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	36,946,395 - 36,957,418 (+)	Ensembl
ChiLan1.0	NW_004955405	36,946,481 - 36,956,472 (+)	NCBI	ChiLan1.0	ChiLan1.0

SPIC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	109,547,215 - 109,561,222 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	109,543,613 - 109,557,620 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	99,062,023 - 99,073,496 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	102,461,606 - 102,472,840 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	102,461,613 - 102,472,840 (+)	Ensembl			panPan2	panpan1.1

SPIC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	40,443,132 - 40,453,894 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	40,442,945 - 40,453,334 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	40,811,804 - 40,822,597 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	41,097,876 - 41,108,724 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	41,097,885 - 41,108,724 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	40,353,028 - 40,363,821 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	40,461,955 - 40,472,685 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	40,736,098 - 40,746,887 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Spic
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	19,521,812 - 19,530,536 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	12,532,389 - 12,539,965 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	12,532,389 - 12,539,965 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SPIC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	82,726,360 - 82,795,864 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	82,724,322 - 82,793,527 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	86,754,444 - 86,757,898 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SPIC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	96,714,929 - 96,746,938 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	96,737,631 - 96,746,715 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	148,256,949 - 148,268,949 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Spic
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624750	6,476,108 - 6,490,261 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Spic
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	167,734,090 - 167,741,947 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Spic
131 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	38
Count of miRNA genes:	35
Interacting mature miRNAs:	36
Transcripts:	ENSRNOT00000064241
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354644	Spl4	Serum phospholipid level QTL 4	4.9		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	7	21541977	51639954	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	23807606	68807606	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	7216097	52216097	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	10517086	62346019	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1709527	46709527	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	24179478	86817926	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	10112916	60150541	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	9460877	54460877	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	29716167	Rat
1354637	Scl30	Serum cholesterol level QTL 30	3.7		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	7	21541977	51639954	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34650782	Rat
1354639	Spl5	Serum phospholipid level QTL 5	3.9		blood LDL phospholipid amount (VT:0010505)	blood low density lipoprotein phospholipid level (CMO:0001568)	7	21541977	35707405	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	32612984	Rat
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1669658	46669658	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
2290372	Gluco33	Glucose level QTL 33	2.71		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	1	31777942	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	32612984	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	21541977	86817926	Rat
1300138	Hrtrt9	Heart rate QTL 9	4.72		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	10498820	55498820	Rat
61369	Mcs2	Mammary carcinoma susceptibility QTL 2	3.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	20920494	37412865	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	17460447	62460447	Rat
70207	Niddm31	Non-insulin dependent diabetes mellitus QTL 31	3.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	20057232	65057232	Rat

Markers in Region

RH128642

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	23,070,032 - 23,070,220 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	29,225,939 - 29,226,126	NCBI	Rnor6.0
Rnor_5.0	7	29,331,522 - 29,331,709	UniSTS	Rnor5.0
RGSC_v3.4	7	25,354,617 - 25,354,804	UniSTS	RGSC3.4
Celera	7	20,229,753 - 20,229,940	UniSTS
Cytogenetic Map	7	q13	UniSTS

RH129700

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	23,069,821 - 23,070,010 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	29,225,728 - 29,225,916	NCBI	Rnor6.0
Rnor_5.0	7	29,331,311 - 29,331,499	UniSTS	Rnor5.0
RGSC_v3.4	7	25,354,406 - 25,354,594	UniSTS	RGSC3.4
Celera	7	20,229,542 - 20,229,730	UniSTS
Cytogenetic Map	7	q13	UniSTS

Spic

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	89,495,253 - 89,495,855 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	91,148,266 - 91,148,867	NCBI	Rnor6.0
Rnor_5.0	2	110,915,619 - 110,916,220	UniSTS	Rnor5.0
Celera	2	85,185,258 - 85,185,859	UniSTS
Cytogenetic Map	2	q23	UniSTS
Cytogenetic Map	7	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	51	109	87	86	55	71	55	6	303	153	11	82	71	85	31	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001400953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001400954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006241225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006241226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064241 ⟹ ENSRNOP00000059180

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	23,069,821 - 23,077,486 (-)	Ensembl
Rnor_6.0 Ensembl	7	29,225,727 - 29,233,392 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111255 ⟹ ENSRNOP00000088834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	24,957,219 - 24,964,900 (-)	Ensembl
mRatBN7.2 Ensembl	7	23,069,826 - 23,077,548 (-)	Ensembl

RefSeq Acc Id:

NM_001400953 ⟹ NP_001387882

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	24,957,213 - 24,964,900 (-)	NCBI
mRatBN7.2	7	23,069,815 - 23,077,502 (-)	NCBI

RefSeq Acc Id:

NM_001400954 ⟹ NP_001387883

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	24,957,213 - 24,964,900 (-)	NCBI
mRatBN7.2	7	23,069,815 - 23,077,502 (-)	NCBI

RefSeq Acc Id:

XM_006241225 ⟹ XP_006241287

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	24,957,213 - 24,964,918 (-)	NCBI
mRatBN7.2	7	23,069,815 - 23,077,517 (-)	NCBI
Rnor_6.0	7	29,225,721 - 29,233,452 (-)	NCBI
Rnor_5.0	7	29,331,304 - 29,339,005 (-)	NCBI

Sequence:

show sequence

TCCTTAAAAATAGCTATTTAATGCAACTCTGCCAGGGTGTTGGGGATAGTGAGAGTCCTTAACA
TCGTACTGATATCGCAACATTGTCTTCCTGACTTGCGTTGAACTGTTTCCACAGACTTTCGTCC
AGCAAGACAGCCTGGGCCAAGCATTTGAAGACGCCTTCGAAGTACTGACACAACATTCCACTGG
AGAAATGCAGTACCCCCCAGAACATAGAAATTACATGGCTATCATTAACCCTTATCCTCACATC
AGAGGCAATTCTAACTACTGTGGAATGTTACCACCCACAGAGGAACCCCTCTATGACTGGAGAG
GTGTAACAAATGGTTCTGCGGACCTGTATTTGGAAGGAAGCTTCCATCAATCCCTACAGAACGT
AGCTGAAACCCAGCTGGTACAAGCCCCTTTCTTCCAGGAAAAGGGAGGAAGAGGCAGGAGGAAG
CTTCGGCTATTTGAATACCTTTTCGAATCCCTGTGCAATTCGGAGATGGTGTCTTGTATCCAGT
GGGTCGACAAAGCCAAAGGCATCTTTCAGTTTATATCAAAAAACAAAGAAAAACTCGCTGAACT
CTGGGGGAAAAGAAAAGGCAACCGGAAACCCATGACTTACCAGAAGATGGCCAGAGCCCTGAGG
AATTATGCCAGAACTGGGGAGATCACAAAAATCCGGAGAAAGCTGACCTACCAGTTCAGTGAAG
CTGTTCTCCAAAGACTTGCTCCGTCTCACTTCCTGGGGAAAGACCTCTTCTACTCACAGTATAA
GCAGCCTGATCAGGGCTATCTCAATTTAAACCATTGGAATGCAAATTACTACGCTCACGCCAGT
TACCAGAGCTGACATTAGCTTCTTCTTGCCTTGCCAGTGTCAAGAGAGCCCATGCTTTAGGATT
TCCAAAGCAAATTGCTTCTCGGTTTTGGGATTCCACACCAGCAAGACAAAAACGCAGAAAGAGA
ATATATAAACAGGCCATGTTTGGACTTCGCTTGTCCTGACAACTTTTAAGGGCCGACATACTGG
TGTTGAAGGGAATGTAGATGTTTCAGAAGCATGCTTCCTGAAGATCACCATTTCTAGTCAACGG
GCTCAGTGTCCGTGAATTGGGTATCCAAGAACATCCTGAAGCCAGAATGTCTTCTCAGAAAAAT
GGGGACACACAGTGGCACTTGGTATTTTTAAATAAACGATTGAATTTGAAGCAACTGAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001387882	(Get FASTA)	NCBI Sequence Viewer
	NP_001387883	(Get FASTA)	NCBI Sequence Viewer
	XP_006241287	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM16999	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000088834
	ENSRNOP00000088834.1

RefSeq Acc Id:	XP_006241287 ⟸ XM_006241225
- Peptide Label:	isoform X1
- UniProtKB:	A6IFP9 (UniProtKB/TrEMBL), D4A5A4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQYPPEHRNYMAIINPYPHIRGNSNYCGMLPPTEEPLYDWRGVTNGSADLYLEGSFHQSLQNVA ETQLVQAPFFQEKGGRGRRKLRLFEYLFESLCNSEMVSCIQWVDKAKGIFQFISKNKEKLAELW GKRKGNRKPMTYQKMARALRNYARTGEITKIRRKLTYQFSEAVLQRLAPSHFLGKDLFYSQYKQ PDQGYLNLNHWNANYYAHASYQS hide sequence

Ensembl Acc Id:

ENSRNOP00000059180 ⟸ ENSRNOT00000064241

Ensembl Acc Id:

ENSRNOP00000088834 ⟸ ENSRNOT00000111255

RefSeq Acc Id:	NP_001387883 ⟸ NM_001400954
- Peptide Label:	isoform 2
- UniProtKB:	A6IFP9 (UniProtKB/TrEMBL), D4A5A4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001387882 ⟸ NM_001400953
- Peptide Label:	isoform 1
- UniProtKB:	A0A8I6A5W3 (UniProtKB/TrEMBL), A6IFP9 (UniProtKB/TrEMBL), D4A5A4 (UniProtKB/TrEMBL)

Protein Domains

ETS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A5A4-F1-model_v2	AlphaFold	D4A5A4	1-213	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695130

Promoter ID:

EPDNEW_R5655

Type:

single initiation site

Name:

Spic_1

Description:

Spi-C transcription factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	29,233,408 - 29,233,468	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306272	AgrOrtholog
BioCyc Gene	G2FUF-34501	BioCyc
Ensembl Genes	ENSRNOG00000005720	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000111255	ENTREZGENE
	ENSRNOT00000111255.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/TrEMBL
InterPro	Ets	UniProtKB/TrEMBL
	ETS_fam	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
NCBI Gene	314711	ENTREZGENE
PANTHER	PTHR11849	UniProtKB/TrEMBL
	TRANSCRIPTION FACTOR SPI-C	UniProtKB/TrEMBL
Pfam	Ets	UniProtKB/TrEMBL
PhenoGen	Spic	PhenoGen
PRINTS	ETSDOMAIN	UniProtKB/TrEMBL
PROSITE	ETS_DOMAIN_2	UniProtKB/TrEMBL
	ETS_DOMAIN_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005720	RatGTEx
SMART	ETS	UniProtKB/TrEMBL
Superfamily-SCOP	SSF46785	UniProtKB/TrEMBL
UniProt	A0A8I6A5W3	ENTREZGENE, UniProtKB/TrEMBL
	A6IFP9	ENTREZGENE, UniProtKB/TrEMBL
	D4A5A4	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-16	Spic	Spi-C transcription factor	Spic	Spi-C transcription factor (Spi-1/PU.1 related)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Spic	Spi-C transcription factor (Spi-1/PU.1 related)	Spic_predicted	Spi-C transcription factor (Spi-1/PU.1 related) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Spic_predicted	Spi-C transcription factor (Spi-1/PU.1 related) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message