Advanced Search (OLGA)

Gene: Sfr1 (SWI5-dependent homologous recombination repair protein 1) Rattus norvegicus

Analyze

Symbol:

Sfr1

Name:

SWI5-dependent homologous recombination repair protein 1

RGD ID:

1305481

Description:

Predicted to enable transcription coactivator activity. Predicted to be involved in cellular response to estrogen stimulus; double-strand break repair via homologous recombination; and positive regulation of DNA-templated transcription. Predicted to be located in centrosome; nucleolus; and nucleoplasm. Predicted to be part of Swi5-Sfr1 complex. Orthologous to human SFR1 (SWI5 dependent homologous recombination repair protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical LOC294030; hypothetical protein LOC294030; liver regeneration-related protein LRRGT00030; LOC294030; LRRGT00030; MEI5 meiotic recombination protein homolog; MEI5 meiotic recombination protein homolog (S. cerevisiae); MEI5 recombination repair protein homolog; MEI5 recombination repair protein homolog (S. cerevisiae); meiosis protein 5 homolog; Meir5; RGD1305481; swi5-dependent recombination DNA repair protein 1 homolog; SWI5-dependent recombination repair 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	256,560,533 - 256,564,547 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	256,560,469 - 256,567,252 (+)	Ensembl				GRCr8
mRatBN7.2	1	246,619,235 - 246,623,250 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	246,597,044 - 246,623,250 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	254,746,330 - 254,750,334 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	261,439,672 - 261,443,687 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	254,088,794 - 254,092,807 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	1	255,896,380 - 255,900,384 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	1	260,812,004 - 260,816,008 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	1	257,580,421 - 257,584,425 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	1	254,135,977 - 254,139,981 (+)	NCBI		F344_StmMcwi
Rnor_6.0	1	267,505,336 - 267,509,350 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	267,483,145 - 267,509,350 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	274,938,291 - 274,942,306 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	253,079,656 - 253,105,342 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	242,385,631 - 242,389,686 (+)	NCBI		Celera
RGSC_v3.1	1	253,366,620 - 253,370,582 (+)	NCBI
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-palmitoylglycerol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chrysene (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

methylmercury chloride (ISO)

miconazole (ISO)

paracetamol (EXP)

resveratrol (ISO)

rotenone (ISO)

tetrachloromethane (ISO)

thapsigargin (EXP)

thimerosal (ISO)

trichloroethene (EXP)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to estrogen stimulus (IEA,ISO)

DNA damage response (IEA)

DNA repair (IEA)

DNA-templated transcription (IEA)

double-strand break repair via homologous recombination (IBA,IEA,ISO,ISS)

positive regulation of DNA-templated transcription (IBA,IEA,ISO,ISS)

Cellular Component

nucleolus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO,ISS)

Swi5-Sfr1 complex (IBA,IEA,ISO,ISS)

Molecular Function

protein binding (ISO)

transcription coactivator activity (IBA,IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:20976249	PMID:21252223	PMID:23874500

Genomics

Comparative Map Data

Sfr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	256,560,533 - 256,564,547 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	256,560,469 - 256,567,252 (+)	Ensembl				GRCr8
mRatBN7.2	1	246,619,235 - 246,623,250 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	246,597,044 - 246,623,250 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	254,746,330 - 254,750,334 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	261,439,672 - 261,443,687 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	254,088,794 - 254,092,807 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	1	255,896,380 - 255,900,384 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	1	260,812,004 - 260,816,008 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	1	257,580,421 - 257,584,425 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	1	254,135,977 - 254,139,981 (+)	NCBI		F344_StmMcwi
Rnor_6.0	1	267,505,336 - 267,509,350 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	267,483,145 - 267,509,350 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	274,938,291 - 274,942,306 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	253,079,656 - 253,105,342 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	242,385,631 - 242,389,686 (+)	NCBI		Celera
RGSC_v3.1	1	253,366,620 - 253,370,582 (+)	NCBI
Cytogenetic Map	1	q54	NCBI

SFR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	104,120,166 - 104,126,383 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	104,122,058 - 104,126,385 (+)	Ensembl			hg38	GRCh38
GRCh37	10	105,879,924 - 105,886,141 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	105,871,806 - 105,876,133 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	105,871,805 - 105,876,132	NCBI
Celera	10	99,622,685 - 99,627,012 (+)	NCBI		Celera
Cytogenetic Map	10	q25.1	NCBI
HuRef	10	99,513,597 - 99,517,924 (+)	NCBI		HuRef
CHM1_1	10	106,165,698 - 106,170,024 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	105,008,277 - 105,014,494 (+)	NCBI		T2T-CHM13v2.0

Sfr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	47,720,159 - 47,724,027 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	47,720,121 - 47,724,027 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	47,731,714 - 47,735,588 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	47,731,682 - 47,735,588 (+)	Ensembl			mm10	GRCm38
MGSCv37	19	47,806,246 - 47,810,078 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	47,785,070 - 47,788,810 (+)	NCBI		MGSCv36	mm8
Celera	19	48,494,121 - 48,497,030 (+)	NCBI		Celera
Cytogenetic Map	19	D1	NCBI
cM Map	19	40.41	NCBI

Sfr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955485	6,521,292 - 6,524,524 (-)	Ensembl
ChiLan1.0	NW_004955485	6,520,747 - 6,525,359 (-)	NCBI	ChiLan1.0	ChiLan1.0

SFR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	115,997,554 - 116,012,885 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	116,002,862 - 116,018,217 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	100,721,780 - 100,726,204 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	104,180,532 - 104,184,880 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	104,180,672 - 104,184,880 (+)	Ensembl			panPan2	panpan1.1

SFR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	16,436,261 - 16,440,219 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	16,436,377 - 16,439,742 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	16,608,887 - 16,612,835 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	16,914,485 - 16,918,426 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	16,908,735 - 16,918,147 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	16,462,577 - 16,466,513 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	16,491,067 - 16,495,007 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	16,629,806 - 16,633,747 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sfr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	30,432,852 - 30,445,933 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936600	2,041,170 - 2,049,357 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936600	2,034,023 - 2,049,131 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SFR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	115,065,057 - 115,073,855 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	115,064,955 - 115,073,856 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	124,982,636 - 124,986,516 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SFR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	97,171,948 - 97,176,232 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	97,172,037 - 97,176,369 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	58,288,755 - 58,293,073 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sfr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624831	3,218,095 - 3,231,870 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sfr1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	47,258,918 - 47,262,833 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sfr1
26 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	46
Interacting mature miRNAs:	55
Transcripts:	ENSRNOT00000016881
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
1598839	Rf56	Renal function QTL 56			renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	255849111	270518180	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat

Markers in Region

RH134383

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	246,622,927 - 246,623,144 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	267,509,028 - 267,509,244	NCBI	Rnor6.0
Rnor_5.0	1	274,941,984 - 274,942,200	UniSTS	Rnor5.0
RGSC_v3.4	1	253,105,539 - 253,105,755	UniSTS	RGSC3.4
Celera	1	242,389,364 - 242,389,580	UniSTS
RH 3.4 Map	1	1623.63	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001047856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096311	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY383685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM118556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016881 ⟹ ENSRNOP00000016881

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	256,560,469 - 256,567,252 (+)	Ensembl
mRatBN7.2 Ensembl	1	246,619,137 - 246,623,219 (+)	Ensembl
Rnor_6.0 Ensembl	1	267,505,336 - 267,509,350 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000088962 ⟹ ENSRNOP00000068947

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	246,597,044 - 246,623,250 (+)	Ensembl
Rnor_6.0 Ensembl	1	267,483,145 - 267,508,831 (+)	Ensembl

RefSeq Acc Id:

NM_001047856 ⟹ NP_001041321

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	256,560,533 - 256,564,547 (+)	NCBI
mRatBN7.2	1	246,619,235 - 246,623,250 (+)	NCBI
Dahl_SR_JrHsd	1	255,896,380 - 255,900,384 (+)	NCBI
Lyon_Normotensive	1	260,812,004 - 260,816,008 (+)	NCBI
Lyon_Hypertensive	1	257,580,421 - 257,584,425 (+)	NCBI
F344_StmMcwi	1	254,135,977 - 254,139,981 (+)	NCBI
Rnor_6.0	1	267,505,336 - 267,509,350 (+)	NCBI
Rnor_5.0	1	274,938,291 - 274,942,306 (+)	NCBI
RGSC_v3.4	1	253,079,656 - 253,105,342 (+)	RGD
Celera	1	242,385,631 - 242,389,686 (+)	NCBI

Sequence:

show sequence

CCCGGGGCGAGGTCAGTGTACTCCGGGCGCTACGCTGGTTGTGTACGCTGTGTCTGCTGTGAGC
ATGGCTGAGGAAGAAGGAAATCAGGAGATCACTTCCAAGATGGAAAACCCCTCAGATTCAGCAT
CCACTTCACCTGACATTCCTCAGACCAGTGAGAATCCACCATCACCCCCAACCTCACCTGACAA
GCCTCAGACCAGTGAAAATCCACCATCACTCCATTCGAATAGTTCAGGAAAACAACCTATGAGT
GGGACACTTAAAGAAAGATTAAAGAAAGCAAGAGCTTCATCTCAACCTTTTTGTAGTGTGGTGA
AGCGTATTAAGGTAGAGAATGAAGAAAATGATCAGACCCTTTCAGAACCAGGAGAATCTTCAAA
AGAAGAAAACTGTTCAAAAGCCCAAGAAAGCCTGGAAAACAAAGACAATGAACCTGAAAAAGAG
AGCTCAGAGGATAAAAATACGAGTGAATCTAAGTCACTTGATACTGGGTCATCCAGTGTCCTCC
AAAAAGATTCTACTGAGAAGACTATAAAGCAAACTTTGAAGGAAGAAAAAGCAAAACTGACTAG
GCAGGTTCAAGAGAAGGAAGACCTTCTTCGGAGGTTAAAGTTAGTCAAAATGTACAGAATAAAG
AATGACGTGACTGAGTTAGAGGATTTAATAAAGAAGTGGAGGAGGTGTGGCCAGCGGCTGCTGT
GCGAGTTGCAGTCAATCATGTCCGAGGATGAGGACGAGAAGCTGACCCTCACTGAGTTGATCGA
CTACTATGGGATAGACGACAAATTGCTGCACTATAATAGAACTGAAGAAGAGTTCACAGGGGTT
TGATACTGTTGTTTTTTTTTTTTTTCTTCTTCAGGCTTTTGTCCCCCTCTCTTCTTGGGGGCCT
CAAAAAATGTGCTCTGTTCCTGAGCTGTACAGTTAGCCCCTTTACAGAATATCTTTGAGAATGG
CAATGAAAAGAGAAATGATTTAAAGGGAAAAAAGATCTAAGCTGTTGTGGCTTAGGCGGAGGAA
TGTTGAACAGTTCGGGATATTCTGACACAAAATTATAAAGCGAAGCTTAGTATTTTGGATATGT
TTGCTAAAGAAAATATTTAAGTATAAAAAAATTAAAATTGTGTTTAAAACAGAGTTTGGATAAT
TCTAGAAACCAGGTTTAATACATTGATTTTTGGGGCAAAAGGTTTTATATTCAGTATTAAAAAG
TAGTCTGTTGAATGTCTAAACCTCACGTGACATAAATGTAACCTGACTCTCTTAAGTTTGTGGA
CCTATCCTCATATGCTTAACATCTGTCTGCTAACTTAGCAGCTAATTAAACTTACCTGTGTACA
GTTTTCTCCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001041321	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ96243	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016881
	ENSRNOP00000068947.1
GenBank Protein	Q6TXG9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001041321 ⟸ NM_001047856

- UniProtKB:

A0A0H2UHK0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAEEEGNQEITSKMENPSDSASTSPDIPQTSENPPSPPTSPDKPQTSENPPSLHSNSSGKQPMS
GTLKERLKKARASSQPFCSVVKRIKVENEENDQTLSEPGESSKEENCSKAQESLENKDNEPEKE
SSEDKNTSESKSLDTGSSSVLQKDSTEKTIKQTLKEEKAKLTRQVQEKEDLLRRLKLVKMYRIK
NDVTELEDLIKKWRRCGQRLLCELQSIMSEDEDEKLTLTELIDYYGIDDKLLHYNRTEEEFTGV

hide sequence

Ensembl Acc Id:

ENSRNOP00000016881 ⟸ ENSRNOT00000016881

Ensembl Acc Id:

ENSRNOP00000068947 ⟸ ENSRNOT00000088962

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6TXG9-F1-model_v2	AlphaFold	Q6TXG9	1-251	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690980

Promoter ID:

EPDNEW_R1505

Type:

initiation region

Name:

Sfr1_1

Description:

SWI5-dependent homologous recombination repair protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	267,505,350 - 267,505,410	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305481	AgrOrtholog
BioCyc Gene	G2FUF-55465	BioCyc
Ensembl Genes	ENSRNOG00000012641	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016881	ENTREZGENE
	ENSRNOT00000088962.2	UniProtKB/Swiss-Prot
Gene3D-CATH	6.10.140.1020	UniProtKB/Swiss-Prot
InterPro	SFR1	UniProtKB/Swiss-Prot
	SFR1/Mei5	UniProtKB/Swiss-Prot
NCBI Gene	294030	ENTREZGENE
PANTHER	PTHR28643	UniProtKB/Swiss-Prot
	SWI5-DEPENDENT RECOMBINATION DNA REPAIR PROTEIN 1 HOMOLOG	UniProtKB/Swiss-Prot
Pfam	Mei5	UniProtKB/Swiss-Prot
PhenoGen	Sfr1	PhenoGen
RatGTEx	ENSRNOG00000012641	RatGTEx
UniProt	A0A0H2UHK0	ENTREZGENE, UniProtKB/TrEMBL
	Q6TXG9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-09	Sfr1	SWI5-dependent homologous recombination repair protein 1	Sfr1	SWI5-dependent recombination repair 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-09-02	Sfr1	SWI5-dependent recombination repair 1	Meir5	MEI5 recombination repair protein homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-16	Meir5	MEI5 recombination repair protein homolog (S. cerevisiae)	Meir5	MEI5 meiotic recombination protein homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Meir5	MEI5 meiotic recombination protein homolog (S. cerevisiae)	RGD1305481	hypothetical LOC294030	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1305481	hypothetical LOC294030	RGD1305481_predicted	hypothetical LOC294030 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1305481_predicted	hypothetical LOC294030 (predicted)	LOC294030_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC294030_predicted	hypothetical LOC294030 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message