Advanced Search (OLGA)

Gene: Vma22 (vacuolar ATPase assembly factor VMA22) Rattus norvegicus

Analyze

Symbol:

Vma22 (Ensembl: Ccdc115)

Name:

vacuolar ATPase assembly factor VMA22 (Ensembl:coiled-coil domain containing 115)

RGD ID:

1304653

Description:

Predicted to enable unfolded protein binding activity. Predicted to be involved in cellular response to increased oxygen levels; intracellular monoatomic cation homeostasis; and lysosomal protein catabolic process. Predicted to be located in several cellular components, including COPI-coated vesicle; endoplasmic reticulum-Golgi intermediate compartment; and lysosome. Predicted to be part of vacuolar proton-transporting V-type ATPase complex. Human ortholog(s) of this gene implicated in congenital disorder of glycosylation type IIo. Orthologous to human CCDC115 (coiled-coil domain containing 115); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ccdc115; coiled-coil domain containing 115; coiled-coil domain-containing protein 115; LOC363213; RGD1304653; similar to 2310061I09Rik protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	VMA22 (vacuolar ATPase assembly factor VMA22)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ccdc115 (coiled-coil domain containing 115)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Vma22 (vacuolar ATPase assembly factor VMA22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	VMA22 (vacuolar ATPase assembly factor VMA22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCDC115 (coiled-coil domain containing 115)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Vma22 (vacuolar ATPase assembly factor VMA22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCDC115 (coiled-coil domain containing 115)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	VMA22 (vacuolar ATPase assembly factor VMA22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Vma22 (vacuolar ATPase assembly factor VMA22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Vma22 (vacuolar ATPase assembly factor VMA22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Ccdc115 (coiled-coil domain containing 115)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	VMA22 (vacuolar ATPase assembly factor VMA22)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccdc115 (coiled-coil domain containing 115)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14671	Alliance	DIOPT (OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG14671	Alliance	DIOPT (OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9592	Alliance	DIOPT (OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	VMA22	Alliance	DIOPT (PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	XB5795058 [provisional]	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	44,146,287 - 44,150,250 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	44,145,161 - 44,149,899 (-)	Ensembl				GRCr8
mRatBN7.2	9	36,650,384 - 36,654,348 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	36,649,271 - 36,653,946 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	45,147,304 - 45,151,268 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	50,278,479 - 50,282,443 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	48,560,393 - 48,564,357 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	37,774,876 - 37,778,839 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	37,775,311 - 37,779,967 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	37,461,820 - 37,465,783 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	33,175,664 - 33,179,627 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	34,441,582 - 34,445,540 (-)	NCBI		Celera
RGSC_v3.1	9	33,175,949 - 33,180,634 (-)	NCBI
Cytogenetic Map	9	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital disorder of glycosylation Ii (ISO)

congenital disorder of glycosylation type IIo (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

acrylamide (EXP)

arsenite(3-) (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (EXP)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

diquat (ISO)

endosulfan (EXP)

folic acid (ISO)

formaldehyde (ISO)

ketamine (EXP)

leflunomide (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to increased oxygen levels (ISO)

intracellular iron ion homeostasis (ISO)

lysosomal lumen acidification (ISO)

lysosomal protein catabolic process (ISO)

vacuolar proton-transporting V-type ATPase complex assembly (IEA)

Cellular Component

COPI-coated vesicle (IEA,ISO)

cytoplasmic vesicle (IEA)

endoplasmic reticulum (ISO)

endoplasmic reticulum-Golgi intermediate compartment (IEA,ISO)

endosome (IEA)

lysosome (IEA)

plasma membrane (ISO)

vacuolar proton-transporting V-type ATPase complex (ISO)

vacuole (IEA)

Molecular Function

protein binding (ISO)

unfolded protein binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:16378758	PMID:19946888	PMID:26833332	PMID:28296633

Genomics

Comparative Map Data

Vma22
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	44,146,287 - 44,150,250 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	44,145,161 - 44,149,899 (-)	Ensembl				GRCr8
mRatBN7.2	9	36,650,384 - 36,654,348 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	36,649,271 - 36,653,946 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	45,147,304 - 45,151,268 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	50,278,479 - 50,282,443 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	48,560,393 - 48,564,357 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	37,774,876 - 37,778,839 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	37,775,311 - 37,779,967 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	37,461,820 - 37,465,783 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	33,175,664 - 33,179,627 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	34,441,582 - 34,445,540 (-)	NCBI		Celera
RGSC_v3.1	9	33,175,949 - 33,180,634 (-)	NCBI
Cytogenetic Map	9	q21	NCBI

VMA22
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	130,337,933 - 130,342,681 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	130,337,922 - 130,342,699 (-)	Ensembl			hg38	GRCh38
GRCh37	2	131,095,506 - 131,100,254 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	130,812,286 - 130,816,392 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	2	124,369,157 - 124,373,263 (-)	NCBI		Celera
Cytogenetic Map	2	q21.1	NCBI
HuRef	2	123,385,790 - 123,389,896 (-)	NCBI		HuRef
CHM1_1	2	131,099,557 - 131,103,663 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	130,771,857 - 130,776,605 (-)	NCBI		T2T-CHM13v2.0

Ccdc115
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	34,475,751 - 34,478,753 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	34,475,751 - 34,478,753 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	34,436,670 - 34,439,672 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	34,436,670 - 34,439,672 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	34,493,515 - 34,496,517 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	34,381,222 - 34,384,218 (-)	NCBI		MGSCv36	mm8
Celera	1	34,199,901 - 34,202,903 (-)	NCBI		Celera
Cytogenetic Map	1	B	NCBI
cM Map	1	13.22	NCBI

Vma22
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955459	25,649 - 30,215 (-)	Ensembl
ChiLan1.0	NW_004955459	25,649 - 30,215 (-)	NCBI	ChiLan1.0	ChiLan1.0

VMA22
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	43,885,061 - 43,889,083 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	43,900,033 - 43,904,055 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	28,624,800 - 28,629,543 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	131,251,053 - 131,255,496 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

CCDC115
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	19,027,014 - 19,031,467 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	19,027,342 - 19,030,887 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	19,058,971 - 19,063,662 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	19,165,691 - 19,170,382 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	19,165,710 - 19,170,382 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	19,026,790 - 19,031,486 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	19,039,432 - 19,044,087 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	19,095,996 - 19,100,692 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Vma22
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	100,530,604 - 100,534,529 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	41,083,738 - 41,087,087 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	41,083,713 - 41,087,106 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCDC115
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	31,974,724 - 31,979,059 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	31,974,715 - 31,979,062 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	35,896,786 - 35,900,719 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

VMA22
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	66,264 - 70,711 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	66,429 - 70,877 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666058	5,647,161 - 5,651,578 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vma22
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624732	14,466,079 - 14,474,561 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624732	14,469,377 - 14,474,540 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Vma22
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	110,664,261 - 110,669,229 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Vma22
42 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	110
Count of miRNA genes:	98
Interacting mature miRNAs:	107
Transcripts:	ENSRNOT00000017722
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	6714888	84474983	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5346479	50346479	Rat
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	40029925	85029925	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	8750492	53750492	Rat
1300180	Bw14	Body weight QTL 14	3.776		body mass (VT:0001259)	body weight (CMO:0000012)	9	31250432	68875676	Rat
61450	Ciaa3	CIA Autoantibody QTL 3	6.5		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	9	29567664	74567664	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	29567664	83835942	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	41720295	86720295	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	496645	45496645	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	6214995	51214995	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	8750492	53750492	Rat
7207805	Bmd88	Bone mineral density QTL 88	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	9	31250432	65651574	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5346479	50416711	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	496645	45496645	Rat
1581517	Bp284	Blood pressure QTL 284			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	39220186	84220186	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	21031430	49025574	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	496645	45496645	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	40029925	85029925	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	6214995	51214995	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	34960590	79960590	Rat
1598823	Memor16	Memory QTL 16	1.9		exploratory behavior trait (VT:0010471)	difference between duration of physical contact or close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	31456061	57460683	Rat

Markers in Region

RH133275

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	36,649,435 - 36,649,643 (-)	MAPPER	mRatBN7.2
Rnor_6.0	9	37,779,580 - 37,779,787	NCBI	Rnor6.0
Rnor_5.0	9	37,466,524 - 37,466,731	UniSTS	Rnor5.0
RGSC_v3.4	9	33,174,716 - 33,174,923	UniSTS	RGSC3.4
Celera	9	34,440,634 - 34,440,841	UniSTS
Cytogenetic Map	9	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	67	162	91	90	59	92	59	6	353	191	9	141	79	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108793	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017722 ⟹ ENSRNOP00000017722

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	44,145,161 - 44,149,815 (-)	Ensembl
mRatBN7.2 Ensembl	9	36,649,271 - 36,653,927 (-)	Ensembl
Rnor_6.0 Ensembl	9	37,775,311 - 37,779,967 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082531

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	44,145,161 - 44,149,899 (-)	Ensembl
mRatBN7.2 Ensembl	9	36,649,271 - 36,653,946 (-)	Ensembl
Rnor_6.0 Ensembl	9	37,775,311 - 37,778,721 (+)	Ensembl

RefSeq Acc Id:

NM_001108793 ⟹ NP_001102263

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	44,146,287 - 44,150,250 (-)	NCBI
mRatBN7.2	9	36,650,384 - 36,654,348 (-)	NCBI
Rnor_6.0	9	37,774,876 - 37,778,839 (+)	NCBI
Rnor_5.0	9	37,461,820 - 37,465,783 (+)	NCBI
RGSC_v3.4	9	33,175,664 - 33,179,627 (-)	RGD
Celera	9	34,441,582 - 34,445,540 (-)	RGD

Sequence:

show sequence

TGCCGTGCAGCTTGCCCCATCTTAAAATGGCGAATGGCGTCGCAAGGTGATTGGTCAGACCGAC
AACCAATCAATTACCCGAATTTGGGATGTCATGTGGCCTAAGGCCGCCCTGATAAATAAGTCCG
TCCGTGGCTTCACCAACGCTTGAGCCAGTCAGGCAGTAGGCTAAGAAAAAGTAAGAGTGGCAAC
TGCGTGGATGGCTTCCTGGACTCGACTTTTCATAGCCATCTGATTCGAGAAATGTTCCGTTCCA
GAAGCTAACCCTCATGCAGGCCGTTGACACGGGTCACCCGGAAGTTGAAACCTTTGACTTCCGG
GCCACGATTAGGAACGCCTCCTAAGGGCGGATCTCGAGCGTTGATTGGCTGACATGCACATGGG
CTCACAGTGATTAGAGGGCTCGGAAGGAAGTGGCTCTGCCCCTCCGCGTCCCAAGACTACCTGG
ACCATGGAGGTCCAGGCCCTGCGAGAGGAATTGGACTCAAAGTGCCTACAGCTGCTTAGTGACC
TGGAGGAACTGGAGGCGAAGAGGGCCGCACTGAACGCCCGGGTGGAGGAGGGTTGGCTTTCACT
TGCCAAGGCTCGCTATGCCATGGGAGCCAAGTCGGTAGGGCCCCTGCAGTATGCCTCGCGTATG
GAGCCTCAGGTCTGCGTGCGCGCCAGCGAGGCCCAGGATGGACCCCAGACCTTCAGAGTGATCA
AAGCTAACGCCCAGATCCCCGAGGAAGTGGGGCCTAGCGAAGCATCTCTGCGCAGGCGCAAGGG
CCCTACCAAGACCAAAGAGTCAGGATCCTCTGTAGTTCCTCAAGATCCCTTGAACTGGTTTGGA
ATCTTGGTTCCTCATAGTCTGCGGCAGGCCCAAGCCAGCTTCCGGGATGGCCTACAGCTGGCTG
CAGATATAGCCAGCCTCCAGACTCGCATCAACTGGGGTCTAAGTCAGCTCCGAGGCCTCCAGAG
AAAACTGAAGGAGTTGGACCCTGGGCCCGCCTGACCTGCATCTACTTTTCGAGGCATTGAGCAT
AGCTGATGTGGATGCTACTGCCTTGTCTTAGGCCTTCTTTCATAAACAGCCCCTGTCTTAGCTG
ATGCCCCTCCTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102263	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66583	(Get FASTA)	NCBI Sequence Viewer
	EDL99311	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017722
	ENSRNOP00000017722.4
	ENSRNOP00000084472.1

RefSeq Acc Id:	NP_001102263 ⟸ NM_001108793
- UniProtKB:	B2GV96 (UniProtKB/TrEMBL), F7FFC1 (UniProtKB/TrEMBL), A0A8I5ZZE3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEVQALREELDSKCLQLLSDLEELEAKRAALNARVEEGWLSLAKARYAMGAKSVGPLQYASRME PQVCVRASEAQDGPQTFRVIKANAQIPEEVGPSEASLRRRKGPTKTKESGSSVVPQDPLNWFGI LVPHSLRQAQASFRDGLQLAADIASLQTRINWGLSQLRGLQRKLKELDPGPA hide sequence

Ensembl Acc Id:

ENSRNOP00000017722 ⟸ ENSRNOT00000017722

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2GV96-F1-model_v2	AlphaFold	B2GV96	1-180	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696590

Promoter ID:

EPDNEW_R7114

Type:

initiation region

Name:

Ccdc115_1

Description:

coiled-coil domain containing 115

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	37,775,297 - 37,775,357	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304653	AgrOrtholog
BioCyc Gene	G2FUF-27862	BioCyc
Ensembl Genes	ENSRNOG00000013234	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017722	ENTREZGENE
	ENSRNOT00000017722.8	UniProtKB/TrEMBL
	ENSRNOT00000082531.3	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.3240	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7442489	IMAGE-MGC_LOAD
InterPro	Vma22/CCDC115	UniProtKB/TrEMBL
KEGG Report	rno:363213	UniProtKB/TrEMBL
MGC_CLONE	MGC:188312	IMAGE-MGC_LOAD
NCBI Gene	363213	ENTREZGENE
PANTHER	COILED-COIL DOMAIN-CONTAINING PROTEIN 115	UniProtKB/TrEMBL
	PTHR31996	UniProtKB/TrEMBL
Pfam	Vma22_CCDC115	UniProtKB/TrEMBL
PhenoGen	Vma22	PhenoGen
RatGTEx	ENSRNOG00000013234	RatGTEx
UniProt	A0A8I5ZZE3	ENTREZGENE, UniProtKB/TrEMBL
	B2GV96	ENTREZGENE, UniProtKB/TrEMBL
	F7FFC1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-11-13	Vma22	vacuolar ATPase assembly factor VMA22	Ccdc115	coiled-coil domain containing 115	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Ccdc115	coiled-coil domain containing 115	RGD1304653_predicted	similar to 2310061I09Rik protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1304653_predicted	similar to 2310061I09Rik protein (predicted)	LOC363213_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC363213_predicted	similar to 2310061I09Rik protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM