Advanced Search (OLGA)

Gene: Ubl7 (ubiquitin-like 7) Rattus norvegicus

Analyze

Symbol:

Ubl7

Name:

ubiquitin-like 7

RGD ID:

1303055

Description:

Predicted to enable polyubiquitin modification-dependent protein binding activity and protein-macromolecule adaptor activity. Predicted to be involved in ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within antiviral innate immune response and protein K27-linked ubiquitination. Predicted to be active in cytosol. Orthologous to human UBL7 (ubiquitin like 7); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Bmsc-UbP; bone marrow stromal cell-derived ubiquitin-like protein; MGC94284; ubiquitin-like 7 (bone marrow stromal cell-derived); ubiquitin-like protein 7

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UBL7 (ubiquitin like 7)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ubl7 (ubiquitin-like 7 (bone marrow stromal cell-derived))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ubl7 (ubiquitin like 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UBL7 (ubiquitin like 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UBL7 (ubiquitin like 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ubl7 (ubiquitin like 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UBL7 (ubiquitin like 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UBL7 (ubiquitin like 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ubl7 (ubiquitin like 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ubl7 (ubiquitin like 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZNF700 (zinc finger protein 700)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Ubl7 (ubiquitin-like 7 (bone marrow stromal cell-derived))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	UBL7 (ubiquitin like 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ubl7b (ubiquitin-like 7b (bone marrow stromal cell-derived))	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	ubl7b (ubiquitin-like 7b (bone marrow stromal cell-derived))	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Danio rerio (zebrafish):	ubl7a (ubiquitin-like 7a (bone marrow stromal cell-derived))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3223	Alliance	DIOPT (Hieranoid\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	ubl7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	67,217,151 - 67,236,224 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	67,216,527 - 67,236,224 (+)	Ensembl				GRCr8
mRatBN7.2	8	58,321,279 - 58,340,353 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	58,320,866 - 58,340,344 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	63,851,760 - 63,869,067 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	62,129,318 - 62,146,624 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	59,993,878 - 60,011,185 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	62,696,557 - 62,715,694 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	62,696,720 - 62,714,017 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	62,471,853 - 62,490,983 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	61,690,384 - 61,707,678 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	57,785,674 - 57,802,972 (+)	NCBI		Celera
RGSC_v3.1	8	61,709,437 - 61,726,732 (+)	NCBI
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

colorectal cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-amino-2,6-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

CGP 52608 (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

coumarin (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

epoxiconazole (ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

FR900359 (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

lead(0) (ISO)

leflunomide (EXP)

lidocaine (EXP)

methidathion (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

rac-lactic acid (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antiviral innate immune response (IEA,ISO)

ubiquitin-dependent protein catabolic process (IBA)

Cellular Component

cytoplasm (IEA,ISO)

cytosol (IBA)

Molecular Function

polyubiquitin modification-dependent protein binding (IBA)

protein binding (ISO)

protein-macromolecule adaptor activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Cloning and identification of a novel ubiquitin-like protein, BMSC-UbP, from human bone marrow stromal cells.	Liu S, etal., Immunol Lett 2003 Apr 3;86(2):169-75.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:22871113

Genomics

Comparative Map Data

Ubl7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	67,217,151 - 67,236,224 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	67,216,527 - 67,236,224 (+)	Ensembl				GRCr8
mRatBN7.2	8	58,321,279 - 58,340,353 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	58,320,866 - 58,340,344 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	63,851,760 - 63,869,067 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	62,129,318 - 62,146,624 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	59,993,878 - 60,011,185 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	62,696,557 - 62,715,694 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	62,696,720 - 62,714,017 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	62,471,853 - 62,490,983 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	61,690,384 - 61,707,678 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	57,785,674 - 57,802,972 (+)	NCBI		Celera
RGSC_v3.1	8	61,709,437 - 61,726,732 (+)	NCBI
Cytogenetic Map	8	q24	NCBI

UBL7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	74,445,977 - 74,461,188 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	74,445,187 - 74,461,182 (-)	Ensembl			hg38	GRCh38
GRCh37	15	74,738,318 - 74,753,529 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	72,525,371 - 72,540,582 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	15	51,685,546 - 51,700,840 (-)	NCBI		Celera
Cytogenetic Map	15	q24.1	NCBI
HuRef	15	51,534,129 - 51,549,341 (-)	NCBI		HuRef
CHM1_1	15	74,856,440 - 74,871,654 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	72,313,701 - 72,328,914 (-)	NCBI		T2T-CHM13v2.0

Ubl7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	57,818,280 - 57,837,624 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	57,818,262 - 57,837,251 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	57,910,978 - 57,929,970 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	57,910,979 - 57,929,968 (+)	Ensembl			mm10	GRCm38
MGSCv37	9	57,758,793 - 57,777,775 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	57,709,123 - 57,728,107 (+)	NCBI		MGSCv36	mm8
Celera	9	55,141,244 - 55,162,257 (+)	NCBI		Celera
Cytogenetic Map	9	B	NCBI
cM Map	9	31.63	NCBI

Ubl7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	3,378,600 - 3,392,601 (+)	Ensembl
ChiLan1.0	NW_004955450	3,379,201 - 3,391,938 (+)	NCBI	ChiLan1.0	ChiLan1.0

UBL7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	63,673,598 - 63,689,597 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	67,837,192 - 67,852,888 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	53,388,333 - 53,403,617 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	73,008,913 - 73,024,221 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	73,008,913 - 73,024,208 (-)	Ensembl			panPan2	panpan1.1

UBL7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	37,563,675 - 37,577,038 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	37,564,058 - 37,577,152 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	37,488,858 - 37,510,897 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	37,760,490 - 37,782,518 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	37,768,000 - 37,782,710 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	37,712,980 - 37,735,214 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	37,738,199 - 37,760,221 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	37,994,061 - 38,016,318 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ubl7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	115,616,403 - 115,630,577 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	33,464,466 - 33,478,667 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	33,464,321 - 33,478,584 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UBL7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	59,070,728 - 59,084,112 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	59,070,666 - 59,084,119 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	63,686,693 - 63,700,144 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UBL7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	9,013,610 - 9,028,077 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	132,600,386 - 132,614,838 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ubl7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	197,368 - 213,370 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624781	197,703 - 212,026 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ubl7
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	51,782,827 - 51,802,017 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ubl7
136 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	25
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000010083
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	50763951	95763951	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	51589699	99045312	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	44477926	89477926	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	58991697	91341052	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	47541419	92541419	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	49610204	68373388	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	44447837	89447837	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	49610204	94610204	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	67378345	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	49245178	94245178	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	50763951	67219641	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	49245178	94245178	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	58991697	91341052	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	44475043	89475043	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	58337123	103337123	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	60248093	105248093	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	58991697	91341052	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	35464071	71842899	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat

Markers in Region

RH141599

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	58,338,519 - 58,338,671 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	62,713,861 - 62,714,012	NCBI	Rnor6.0
Rnor_5.0	8	62,489,150 - 62,489,301	UniSTS	Rnor5.0
RGSC_v3.4	8	61,707,522 - 61,707,673	UniSTS	RGSC3.4
Celera	8	57,802,816 - 57,802,967	UniSTS
RH 3.4 Map	8	667.3	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004247	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001413519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001413520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429278	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429281	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119518	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010083 ⟹ ENSRNOP00000010083

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	58,321,259 - 58,338,676 (+)	Ensembl
Rnor_6.0 Ensembl	8	62,696,720 - 62,714,017 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114949 ⟹ ENSRNOP00000094185

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	67,217,259 - 67,236,224 (+)	Ensembl
mRatBN7.2 Ensembl	8	58,320,866 - 58,340,344 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117925 ⟹ ENSRNOP00000083337

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	67,216,527 - 67,236,217 (+)	Ensembl
mRatBN7.2 Ensembl	8	58,322,190 - 58,340,344 (+)	Ensembl

RefSeq Acc Id:

NM_001004247 ⟹ NP_001004247

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,217,259 - 67,236,224 (+)	NCBI
mRatBN7.2	8	58,321,387 - 58,340,353 (+)	NCBI
Rnor_6.0	8	62,696,720 - 62,714,017 (+)	NCBI
Rnor_5.0	8	62,471,853 - 62,490,983 (+)	NCBI
RGSC_v3.4	8	61,690,384 - 61,707,678 (+)	RGD
Celera	8	57,785,674 - 57,802,972 (+)	RGD

Sequence:

show sequence

CGTGGGTCCGGAGTAGCTAACTGGTCCCACGAGAGAGGTGGGGTTGTCAACACTGTCCCTACTC
ACGACTAGGGAGAAAGAGAGAGCGAGAGAGAGAGAGGATGTCTCTCTCAGACTGGCACTTGGCA
GTGAAGCTGGCTGACCAGCCACTTGCTCCCAAATCTATTCTTCAGTTGCCAGAGACAGAACTGG
GAGAATATTCCCTCGGGGGCTATAGCATTTCGTTTCTAAAGCAGCTTATTGCTGGCAAGCTCCA
GGAATCTGTTCCAGACCCGGAGCTGATAGATTTGATCTACTGTGGCCGGAAGCTTAAAGATGAC
CAGACTCTTGACTTCTATGGTATTCAGCCTGGATCCACAGTTCATGTTCTCCGAAAATCTTGGC
CTGAGCCTGATCAGAAACCTGAACCAGTGGACAAAGTGGCTGCCCTGAGAGAGTTCCGAGTCCT
GCACACTGCCCTGCACAGCAGCTCTTCCTACAGAGAGGCAGTCTTTAAGATGCTCAACAATAAA
GAATCTCTGGATCAGATCATCGTGGCAACCCCAGGCCTCAGCAGTGACCCCATTGCTCTAGGGG
TTCTCCAGGATAAGGACCTCTTCTCTGTCTTTGCTGATCCCAACATGCTAGATACATTGGTGCC
TGCTCACCCAGCCCTAGTCAATGCCATCATCCTGGTTCTGCACTCTGTAGCAGGCAGCACCCCA
ATGCCAGGAGCTGATTCCTCTTCCCGAAGCATGCCCTCCAGCTCCTACCGAGATATGCCAGGTG
GTTTCCTGTTTGACGGGCTCTCAGATGACGAGGACGACTTCCACCCAAGCACTCGGTCCACACC
CTCTAGCAGTACACCCAGCTCCCGCCCCGCCTCTCTGGGATACAGTGGAGCTGCAGGGCCCCGC
CCCATCACCCAGAGCGAGCTGGCCACTGCCCTGGCCCTGGCCAGTACTCCAGAGAGCAGTTCTC
ATACACCAACTCCTGGCACCCAGGGGCACTCTTCGGGCACCTCGCCAATGTCCTCTGGTGTCCA
GTCAGGGACACCCATCACCAACGATCTTTTTAGCCAAGCCCTCCAGCATGCCCTGCAGGCCTCT
GGGCAGCAGCCCAGCCTTCAGAGCCAGTGGCAGCCTCAGCTGCAGCAGTTGCGTGATATGGGCA
TCCAGGATGACGAGCTGAGCCTCCGGGCCCTTCAGGCCACTGGAGGTGACATCCAAGCAGCTCT
GGAACTCATCTTTGCTGGAGGAGCCCCATGAACTTCTTGTACCCAAACACCTAGCAAATTGCGG
AAGCTATTCCTGGCAGGAGGCACTTGTGAAGTTGCTTCTAGATCCCACCCCAACCCCACCCAAT
ATATCTGATGCTCCCCTCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001413519 ⟹ NP_001400448

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,217,168 - 67,236,224 (+)	NCBI
mRatBN7.2	8	58,321,296 - 58,340,353 (+)	NCBI

RefSeq Acc Id:

NM_001413520 ⟹ NP_001400449

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,217,151 - 67,236,224 (+)	NCBI
mRatBN7.2	8	58,321,279 - 58,340,353 (+)	NCBI

RefSeq Acc Id:

XM_039081089 ⟹ XP_038937017

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,217,205 - 67,234,547 (+)	NCBI
mRatBN7.2	8	58,321,392 - 58,340,353 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001004247	(Get FASTA)	NCBI Sequence Viewer
	NP_001400448	(Get FASTA)	NCBI Sequence Viewer
	NP_001400449	(Get FASTA)	NCBI Sequence Viewer
	NP_001416203	(Get FASTA)	NCBI Sequence Viewer
	NP_001416204	(Get FASTA)	NCBI Sequence Viewer
	NP_001416205	(Get FASTA)	NCBI Sequence Viewer
	NP_001416206	(Get FASTA)	NCBI Sequence Viewer
	NP_001416207	(Get FASTA)	NCBI Sequence Viewer
	NP_001416208	(Get FASTA)	NCBI Sequence Viewer
	NP_001416209	(Get FASTA)	NCBI Sequence Viewer
	NP_001416210	(Get FASTA)	NCBI Sequence Viewer
	NP_001416211	(Get FASTA)	NCBI Sequence Viewer
	NP_001416212	(Get FASTA)	NCBI Sequence Viewer
	XP_038937017	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79221	(Get FASTA)	NCBI Sequence Viewer
	EDL95657	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000083337
	ENSRNOP00000083337.2
	ENSRNOP00000094185
	ENSRNOP00000094185.2

RefSeq Acc Id:

NP_001004247 ⟸ NM_001004247

- UniProtKB:

Q6AY24 (UniProtKB/TrEMBL), A0A8I5ZWS3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSLSDWHLAVKLADQPLAPKSILQLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLI
YCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAALREFRVLHTALHSSSSYRE
AVFKMLNNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIILV
LHSVAGSTPMPGADSSSRSMPSSSYRDMPGGFLFDGLSDDEDDFHPSTRSTPSSSTPSSRPASL
GYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQ
ALQHALQASGQQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP

hide sequence

Ensembl Acc Id:

ENSRNOP00000010083 ⟸ ENSRNOT00000010083

RefSeq Acc Id:	XP_038937017 ⟸ XM_039081089
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000083337 ⟸ ENSRNOT00000117925

Ensembl Acc Id:

ENSRNOP00000094185 ⟸ ENSRNOT00000114949

RefSeq Acc Id:	NP_001400449 ⟸ NM_001413520
- UniProtKB:	Q6AY24 (UniProtKB/TrEMBL), A0A8I5ZWS3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001400448 ⟸ NM_001413519
- UniProtKB:	Q6AY24 (UniProtKB/TrEMBL), A0A8I5ZWS3 (UniProtKB/TrEMBL)

Protein Domains

UBA Ubiquitin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AY24-F1-model_v2	AlphaFold	Q6AY24	1-381	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696023

Promoter ID:

EPDNEW_R6548

Type:

initiation region

Name:

Ubl7_1

Description:

ubiquitin-like 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	62,696,638 - 62,696,698	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303055	AgrOrtholog
BioCyc Gene	G2FUF-30286	BioCyc
Ensembl Genes	ENSRNOG00000007442	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000114949	ENTREZGENE
	ENSRNOT00000114949.2	UniProtKB/TrEMBL
	ENSRNOT00000117925	ENTREZGENE
	ENSRNOT00000117925.2	UniProtKB/TrEMBL
Gene3D-CATH	DNA helicase RuvA subunit, C-terminal domain	UniProtKB/TrEMBL
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7131980	IMAGE-MGC_LOAD
InterPro	UBA-like	UniProtKB/TrEMBL
	UBA/transl_elong_EF1B_N_euk	UniProtKB/TrEMBL
	Ubiquilin	UniProtKB/TrEMBL
	Ubiquitin	UniProtKB/TrEMBL
	Ubiquitin-rel_dom	UniProtKB/TrEMBL
	UBL7_UBA	UniProtKB/TrEMBL
	UBL7_Ubl	UniProtKB/TrEMBL
KEGG Report	rno:300744	UniProtKB/TrEMBL
MGC_CLONE	MGC:94284	IMAGE-MGC_LOAD
NCBI Gene	300744	ENTREZGENE
PANTHER	UBIQUILIN	UniProtKB/TrEMBL
	UBIQUITIN-LIKE PROTEIN 7	UniProtKB/TrEMBL
Pfam	ubiquitin	UniProtKB/TrEMBL
PhenoGen	Ubl7	PhenoGen
PROSITE	UBA	UniProtKB/TrEMBL
	UBIQUITIN_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007442	RatGTEx
SMART	UBA	UniProtKB/TrEMBL
	UBQ	UniProtKB/TrEMBL
Superfamily-SCOP	SSF54236	UniProtKB/TrEMBL
	UBA_like	UniProtKB/TrEMBL
UniProt	A0A8I5ZWS3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AJ06_RAT	UniProtKB/TrEMBL
	Q6AY24	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-03-13	Ubl7	ubiquitin-like 7	Ubl7	ubiquitin-like 7 (bone marrow stromal cell-derived)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Ubl7	ubiquitin-like 7 (bone marrow stromal cell-derived)	Bmsc-UbP	bone marrow stromal cell-derived ubiquitin-like protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-11	Bmsc-UbP	Fc fragment of IgG, low affinity IIIa, receptor for (CD16)	MGC94284	bone marrow stromal cell-derived ubiquitin-like protein	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar