Advanced Search (OLGA)

Gene: Ak6 (adenylate kinase 6) Rattus norvegicus

Analyze

Symbol:

Ak6

Name:

adenylate kinase 6

RGD ID:

7387335

Description:

Predicted to enable AMP kinase activity and ATP binding activity. Predicted to be involved in nucleoside monophosphate phosphorylation; rRNA processing; and ribosomal small subunit biogenesis. Predicted to be located in Cajal body; centrosome; and nuclear speck. Predicted to be active in cytoplasm and nucleus. Orthologous to human AK6 (adenylate kinase 6); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

adenylate kinase isoenzyme 6; AK/ATPase; ATP-AMP transphosphorylase 6; coilin-interacting nuclear ATPase protein; dual activity adenylate kinase/ATPase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AK6 (adenylate kinase 6)	RGD	RGD
Mus musculus (house mouse):	Ak6 (adenylate kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ak6 (adenylate kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AK6 (adenylate kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AK6 (adenylate kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ak6 (adenylate kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AK6 (adenylate kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AK6 (adenylate kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ak6 (adenylate kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ak6 (adenylate kinase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	AK6 (adenylate kinase 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ak6 (adenylate kinase 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:86811	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ak6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ak6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	E02H1.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	FAP7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ak6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	33,528,388 - 33,540,445 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	33,528,035 - 33,540,441 (+)	Ensembl				GRCr8
GRCr8 Ensembl	20	25,574,974 - 25,575,697 (+)	Ensembl				GRCr8
mRatBN7.2	2	31,794,316 - 31,806,375 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	31,794,519 - 31,806,371 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	20	25,576,483 - 25,576,998 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	38,928,842 - 38,940,871 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	36,969,330 - 36,981,235 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	31,827,274 - 31,839,138 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	33,712,637 - 33,724,682 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	2	33,740,954 - 33,752,818 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	2	33,645,181 - 33,657,045 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	2	33,507,723 - 33,519,747 (+)	NCBI		F344_StmMcwi
Rnor_6.0	2	30,664,407 - 30,676,464 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	30,664,217 - 30,676,464 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	20	27,129,291 - 27,129,806 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	49,824,043 - 49,836,100 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	2	27,807,006 - 27,818,863 (+)	NCBI		Celera
Cytogenetic Map	2	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin M1 (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

bisphenol A (EXP)

cadmium dichloride (EXP)

chromium(6+) (ISO)

clotrimazole (EXP)

Cuprizon (EXP)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

endosulfan (EXP)

folic acid (ISO)

gentamycin (EXP)

ivermectin (ISO)

methimazole (EXP)

paraquat (EXP)

resveratrol (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trovafloxacin (ISO)

tungsten (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

nucleoside monophosphate phosphorylation (IEA)

ribosomal small subunit biogenesis (IEA)

ribosome biogenesis (IEA)

rRNA processing (IEA)

Cellular Component

Cajal body (IEA,ISO,ISS)

cytoplasm (IBA,IEA)

nuclear speck (ISO)

nucleolus (ISO,ISS)

nucleoplasm (IEA,ISO,ISS)

nucleus (IBA,IEA)

Molecular Function

AMP kinase activity (IBA,IEA,ISO,ISS)

ATP binding (IBA,IEA)

ATP hydrolysis activity (IEA)

kinase activity (IEA)

nucleotide binding (IEA)

transferase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:12477932	PMID:15489334	PMID:15630091	PMID:15632090	PMID:16079131	PMID:19946888

Genomics

Comparative Map Data

Ak6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	33,528,388 - 33,540,445 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	33,528,035 - 33,540,441 (+)	Ensembl				GRCr8
GRCr8 Ensembl	20	25,574,974 - 25,575,697 (+)	Ensembl				GRCr8
mRatBN7.2	2	31,794,316 - 31,806,375 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	31,794,519 - 31,806,371 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	20	25,576,483 - 25,576,998 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	38,928,842 - 38,940,871 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	36,969,330 - 36,981,235 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	31,827,274 - 31,839,138 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	33,712,637 - 33,724,682 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	2	33,740,954 - 33,752,818 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	2	33,645,181 - 33,657,045 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	2	33,507,723 - 33,519,747 (+)	NCBI		F344_StmMcwi
Rnor_6.0	2	30,664,407 - 30,676,464 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	30,664,217 - 30,676,464 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	20	27,129,291 - 27,129,806 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	49,824,043 - 49,836,100 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	2	27,807,006 - 27,818,863 (+)	NCBI		Celera
Cytogenetic Map	2	q12	NCBI

AK6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	69,350,984 - 69,369,824 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	69,350,984 - 69,370,013 (-)	Ensembl			hg38	GRCh38
GRCh37	5	68,646,811 - 68,665,651 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Cytogenetic Map	5	q13.2	NCBI
HuRef	5	65,603,597 - 65,621,883 (-)	NCBI		HuRef
CHM1_1	5	68,647,401 - 68,665,684 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	70,176,769 - 70,195,609 (-)	NCBI		T2T-CHM13v2.0

Ak6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	100,787,851 - 100,802,923 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	100,787,487 - 100,802,867 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	100,651,343 - 100,666,415 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	100,650,979 - 100,666,359 (+)	Ensembl			mm10	GRCm38
Celera	13	104,261,518 - 104,276,058 (+)	NCBI		Celera
Cytogenetic Map	13	D1	NCBI

Ak6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955575	60,481 - 78,415 (-)	Ensembl
ChiLan1.0	NW_004955575	61,082 - 78,415 (-)	NCBI	ChiLan1.0	ChiLan1.0

AK6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	44,549,846 - 44,567,894 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	42,703,471 - 42,721,447 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	44,630,692 - 44,649,166 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	46,201,985 - 46,220,364 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	46,201,985 - 46,220,364 (+)	Ensembl			panPan2	panpan1.1

AK6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	54,390,411 - 54,406,872 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	54,390,411 - 54,406,872 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	51,356,906 - 51,373,134 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	54,901,418 - 54,917,916 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	54,901,418 - 54,917,942 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	51,960,190 - 51,976,409 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	52,735,500 - 52,749,699 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	53,623,775 - 53,640,092 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ak6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	191,315,967 - 191,329,147 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936691	165,381 - 166,067 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0 Ensembl	NW_004936480	252,435 - 265,605 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936480	252,435 - 265,615 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AK6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	47,480,557 - 47,500,018 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	47,480,556 - 47,499,656 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	51,338,643 - 51,356,750 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AK6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	65,435,848 - 65,456,343 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	65,434,782 - 65,456,000 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666049	14,171,677 - 14,192,710 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ak6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624905	228,706 - 244,656 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla_female_1.0 Ensembl	NW_004624805	2,392,044 - 2,392,637 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624905	228,751 - 244,656 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ak6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	158,035,070 - 158,046,934 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ak6
83 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	72
Count of miRNA genes:	62
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000031053, ENSRNOT00000061166
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	13325041	58325041	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	24117813	69117813	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
738010	Lnnr3	Liver neoplastic nodule remodeling QTL 3	2.94		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	2	1	42977529	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
9590080	Insglur4	Insulin/glucose ratio QTL 4	28.7	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	2	6152767	51152767	Rat
1579916	Bp270	Blood pressure QTL 270		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	16051883	61051883	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	22038044	67038044	Rat
731166	Mamtr2	Mammary tumor resistance QTL 2		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	54623581	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	28889991	73889991	Rat
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	14368707	59368707	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	44538110	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	83465677	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	5736325	50736325	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	18227137	63227137	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1582246	Cm60	Cardiac mass QTL 60	5.8		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	33269996	78269996	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	73652666	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
25	23	116	273	176	174	112	117	112	12	565	289	11	232	123	150	62	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ205289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ323055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031053 ⟹ ENSRNOP00000033728

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	25,574,974 - 25,575,697 (+)	Ensembl
mRatBN7.2 Ensembl	20	25,576,483 - 25,576,998 (+)	Ensembl
Rnor_6.0 Ensembl	20	27,129,291 - 27,129,806 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000061166 ⟹ ENSRNOP00000057879

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	33,529,643 - 33,540,441 (+)	Ensembl
mRatBN7.2 Ensembl	2	31,794,519 - 31,806,371 (+)	Ensembl
Rnor_6.0 Ensembl	2	30,664,441 - 30,676,464 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076061 ⟹ ENSRNOP00000068116

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	31,794,572 - 31,798,411 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076484 ⟹ ENSRNOP00000068397

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	31,794,326 - 31,798,310 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076786 ⟹ ENSRNOP00000068424

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	33,531,368 - 33,533,090 (+)	Ensembl
mRatBN7.2 Ensembl	2	31,794,142 - 31,798,769 (+)	Ensembl
Rnor_6.0 Ensembl	2	30,664,217 - 30,668,408 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000131201 ⟹ ENSRNOP00000102570

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	33,531,368 - 33,536,078 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000145270 ⟹ ENSRNOP00000105880

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	33,528,035 - 33,540,416 (+)	Ensembl

RefSeq Acc Id:

NM_001012463 ⟹ NP_001012481

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,528,388 - 33,540,445 (+)	NCBI
mRatBN7.2	2	31,794,316 - 31,806,375 (+)	NCBI
Dahl_SR_JrHsd	2	33,712,637 - 33,724,682 (+)	NCBI
Lyon_Normotensive	2	33,740,954 - 33,752,818 (+)	NCBI
Lyon_Hypertensive	2	33,645,181 - 33,657,045 (+)	NCBI
F344_StmMcwi	2	33,507,723 - 33,519,747 (+)	NCBI
Rnor_6.0	2	30,664,407 - 30,676,464 (+)	NCBI
Rnor_5.0	2	49,824,043 - 49,836,100 (+)	NCBI
Celera	2	27,807,006 - 27,818,863 (+)	NCBI

Sequence:

show sequence

CTCCCTGGAGAGCGCGTGAGCCGAAGCGCTGGCTGCGTGTGAAGGAGTACTATGAAGCTTCCGA
ACATCCTGCTCACCGGTACACCAGGGGTTGGAAAAACCACACTAGGCAAAGAACTTGCATCAAG
ATCAGGCCTGAAGTACGTTAATGTGGGAGATCTAGCTCGGGAAGGGCACTTGTACGATGGCTAT
GATGAGGAGTATGGCTGCCCCATCCTAGATGAGGACAGGGTTGTGGACGAGTTAGAGCCTCAGA
TGACAGAGGGCGGCGTGATCGTTGATTACCACGGTTGTGATTTCTTTCCTGAACGCTGGTTCCA
TATAGTGTTCGTGTTGAGGACAGACAATGGTATATTGTACAAACGACTTGAAACAAGGGGTTAT
CACGAGAAGAAACTACAAGATAATATTCAGTGTGAGATTTTTCAAGTTCTCTATGAAGAAGCCA
TGGCATCTTACAAAGAAGAAATTGTGCATCAGCTGCCCAGTAACGAGCCAGAGCAGCTAGAGGA
CAATATCAACCAAATCTCAAAGTGGATCGAGCAGTGGGTGAAAGACCACAACCCTTAACTTAGA
GGCCGGGCAGCTGGGCAGCCAGGCCACCGCAGTCCACACCTTCAGTCTCAGATCTTAGGAGGCA
GCAGCCGGTCTACACAGTGAGTTCTAGGCCAGCGAGGGCTGCACAGTAAGACTCTGTTTCATAG
AAAGAAGACCTGGCCCCAGTCACTCGGTCCACACAGTACAAATGCCTAAGGATGAGCAGAAGAA
AACTTGGGTTGCAGCTCTAGCTGCTGCCTGGTTTCTTTTTCTCCATGAGAAAGCTTAAACAATC
TCAGATATGAATATAACTTATTAAAGGTTGAAAATTGCCTTCAAATTGAATTGATAATAAATCT
GATTAATGGGTACATATCTCTTAAATTTAATCACTAAAATGTAGGTGATCGCTTAAAATAAAAA
TGGAAAATTAAAGATACAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001012481	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89989	(Get FASTA)	NCBI Sequence Viewer
	ABC50104	(Get FASTA)	NCBI Sequence Viewer
	EDM10206	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000057879
GenBank Protein	Q5EB68	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001012481 ⟸ NM_001012463
- UniProtKB:	A6XB81 (UniProtKB/Swiss-Prot), Q5EB68 (UniProtKB/Swiss-Prot), F1M4P9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKLPNILLTGTPGVGKTTLGKELASRSGLKYVNVGDLAREGHLYDGYDEEYGCPILDEDRVVDE LEPQMTEGGVIVDYHGCDFFPERWFHIVFVLRTDNGILYKRLETRGYHEKKLQDNIQCEIFQVL YEEAMASYKEEIVHQLPSNEPEQLEDNINQISKWIEQWVKDHNP hide sequence

Ensembl Acc Id:

ENSRNOP00000033728 ⟸ ENSRNOT00000031053

Ensembl Acc Id:

ENSRNOP00000057879 ⟸ ENSRNOT00000061166

Ensembl Acc Id:

ENSRNOP00000068424 ⟸ ENSRNOT00000076786

Ensembl Acc Id:

ENSRNOP00000068116 ⟸ ENSRNOT00000076061

Ensembl Acc Id:

ENSRNOP00000068397 ⟸ ENSRNOT00000076484

Ensembl Acc Id:

ENSRNOP00000102570 ⟸ ENSRNOT00000131201

Ensembl Acc Id:

ENSRNOP00000105880 ⟸ ENSRNOT00000145270

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5EB68-F1-model_v2	AlphaFold	Q5EB68	1-172	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691108

Promoter ID:

EPDNEW_R1632

Type:

initiation region

Name:

Ak6_1

Description:

adenylate kinase 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	30,664,422 - 30,664,482	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:7387335	AgrOrtholog
BioCyc Gene	G2FUF-54656	BioCyc
BioCyc Pathway	PWY-7219 [adenosine ribonucleotides de novo biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7219	BioCyc
Ensembl Genes	ENSRNOG00000026813	Ensembl
	ENSRNOG00000039848	Ensembl
	ENSRNOG00000063018	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000061166	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
InterPro	Adenyl_kinase_AK6	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:102238592	UniProtKB/Swiss-Prot
NCBI Gene	Taf9	ENTREZGENE
PANTHER	ADENYLATE KINASE ISOENZYME 6	UniProtKB/Swiss-Prot
	PTHR12595	UniProtKB/Swiss-Prot
Pfam	AAA_18	UniProtKB/Swiss-Prot
PhenoGen	Ak6	PhenoGen
RatGTEx	ENSRNOG00000026813	RatGTEx
	ENSRNOG00000039848	RatGTEx
	ENSRNOG00000063018	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8L2UMU3_RAT	UniProtKB/TrEMBL
	A0ABK0LW10_RAT	UniProtKB/TrEMBL
	A6XB81	ENTREZGENE
	F1M4P9	ENTREZGENE, UniProtKB/TrEMBL
	KAD6_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A6XB81	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-10-29	Ak6	adenylate kinase 6			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

BioCyc Pathways