Symbol:
Cfdp1
Name:
craniofacial development protein 1
RGD ID:
735080
Description:
Predicted to be involved in chromatin remodeling. Predicted to act upstream of or within several processes, including cell adhesion; negative regulation of fibroblast apoptotic process; and regulation of cell shape. Predicted to be located in kinetochore. Predicted to be part of Swr1 complex. Orthologous to human CFDP1 (craniofacial development protein 1); INTERACTS WITH beta-naphthoflavone; bisphenol A; Brodifacoum.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
bucentaur
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CFDP1 (craniofacial development protein 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cfdp1 (craniofacial development protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cfdp1 (craniofacial development protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CFDP1 (craniofacial development protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CFDP1 (craniofacial development protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cfdp1 (craniofacial development protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CFDP1 (craniofacial development protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CFDP1 (craniofacial development protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cfdp1 (craniofacial development protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CFDP1 (craniofacial development protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cfdp1 (craniofacial development protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cfdp1 (craniofacial development protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F39H11.1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SWC5
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB)
Drosophila melanogaster (fruit fly):
Yeti
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cfdp1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 56,627,596 - 56,733,099 (-) NCBI GRCr8 mRatBN7.2 19 39,718,313 - 39,823,824 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 39,718,347 - 39,823,824 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 46,593,774 - 46,682,060 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 47,247,092 - 47,335,387 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 49,491,050 - 49,579,816 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 43,989,596 - 44,078,320 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 43,971,474 - 44,078,336 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 54,796,566 - 54,885,236 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 41,703,586 - 41,792,613 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 41,708,466 - 41,797,494 (-) NCBI Celera 19 39,095,820 - 39,183,251 (-) NCBI Celera Cytogenetic Map 19 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cfdp1 Rat 1,2-dimethylhydrazine multiple interactions ISO Cfdp1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CFDP1 mRNA CTD PMID:22206623 Cfdp1 Rat 17alpha-ethynylestradiol affects expression ISO Cfdp1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of CFDP1 mRNA CTD PMID:17555576 Cfdp1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cfdp1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of CFDP1 mRNA CTD PMID:16214954 Cfdp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cfdp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CFDP1 mRNA CTD PMID:21570461 Cfdp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cfdp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CFDP1 mRNA CTD PMID:15328365 more ... Cfdp1 Rat 2-hydroxypropanoic acid decreases expression ISO CFDP1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CFDP1 mRNA CTD PMID:30851411 Cfdp1 Rat 4,4'-sulfonyldiphenol increases expression ISO Cfdp1 (Mus musculus) 6480464 bisphenol S results in increased expression of CFDP1 mRNA CTD PMID:39298647 Cfdp1 Rat 5-aza-2'-deoxycytidine affects expression ISO CFDP1 (Homo sapiens) 6480464 Decitabine affects the expression of CFDP1 mRNA CTD PMID:23300844 Cfdp1 Rat aflatoxin B1 decreases methylation ISO CFDP1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CFDP1 promoter CTD PMID:30157460 Cfdp1 Rat antirheumatic drug increases expression ISO CFDP1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of CFDP1 mRNA CTD PMID:24449571 Cfdp1 Rat aristolochic acid A decreases expression ISO CFDP1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CFDP1 mRNA CTD PMID:33212167 Cfdp1 Rat Aroclor 1254 decreases expression ISO Cfdp1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of CFDP1 mRNA CTD PMID:23650126 Cfdp1 Rat atrazine increases expression ISO CFDP1 (Homo sapiens) 6480464 Atrazine results in increased expression of CFDP1 mRNA CTD PMID:22378314 Cfdp1 Rat benzo[a]pyrene increases expression ISO Cfdp1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CFDP1 mRNA CTD PMID:22228805 Cfdp1 Rat benzo[a]pyrene increases expression ISO CFDP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CFDP1 mRNA CTD PMID:21632981 Cfdp1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CFDP1 mRNA CTD PMID:18164116 Cfdp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CFDP1 mRNA CTD PMID:25181051 Cfdp1 Rat bisphenol A decreases expression ISO Cfdp1 (Mus musculus) 6480464 bisphenol A results in decreased expression of CFDP1 mRNA CTD PMID:33221593 Cfdp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CFDP1 mRNA CTD PMID:30816183 and PMID:32528016 Cfdp1 Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of CFDP1 protein CTD PMID:28903499 Cfdp1 Rat CGP 52608 multiple interactions ISO CFDP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CFDP1 gene] CTD PMID:28238834 Cfdp1 Rat chlorpyrifos decreases expression ISO Cfdp1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CFDP1 mRNA CTD PMID:37019170 Cfdp1 Rat choline multiple interactions ISO Cfdp1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CFDP1 gene CTD PMID:20938992 Cfdp1 Rat cisplatin affects expression ISO CFDP1 (Homo sapiens) 6480464 Cisplatin affects the expression of CFDP1 mRNA CTD PMID:23300844 Cfdp1 Rat copper(II) sulfate decreases expression ISO CFDP1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CFDP1 mRNA CTD PMID:19549813 Cfdp1 Rat Cuprizon multiple interactions ISO CFDP1 (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in decreased expression of CFDP1 protein CTD PMID:34122009 Cfdp1 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of CFDP1 mRNA CTD PMID:22546817 Cfdp1 Rat dicrotophos decreases expression ISO CFDP1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of CFDP1 mRNA CTD PMID:28302478 Cfdp1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of CFDP1 mRNA CTD PMID:22546817 Cfdp1 Rat diuron decreases expression ISO CFDP1 (Homo sapiens) 6480464 Diuron results in decreased expression of CFDP1 mRNA CTD PMID:35967413 Cfdp1 Rat dorsomorphin multiple interactions ISO CFDP1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CFDP1 mRNA CTD PMID:27188386 Cfdp1 Rat epoxiconazole increases expression ISO Cfdp1 (Mus musculus) 6480464 epoxiconazole results in increased expression of CFDP1 mRNA CTD PMID:35436446 Cfdp1 Rat ethanol affects splicing ISO Cfdp1 (Mus musculus) 6480464 Ethanol affects the splicing of CFDP1 mRNA CTD PMID:30319688 Cfdp1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of CFDP1 mRNA CTD PMID:30307764 Cfdp1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of CFDP1 mRNA CTD PMID:24136188 Cfdp1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CFDP1 mRNA CTD PMID:24136188 Cfdp1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CFDP1 mRNA CTD PMID:24793618 Cfdp1 Rat folic acid multiple interactions ISO Cfdp1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Cfdp1 Rat haloperidol multiple interactions ISO CFDP1 (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in decreased expression of CFDP1 protein CTD PMID:34122009 Cfdp1 Rat ivermectin decreases expression ISO CFDP1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CFDP1 protein CTD PMID:32959892 Cfdp1 Rat L-methionine multiple interactions ISO Cfdp1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CFDP1 gene CTD PMID:20938992 Cfdp1 Rat methylmercury chloride increases expression ISO CFDP1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CFDP1 mRNA CTD PMID:28001369 Cfdp1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CFDP1 mRNA CTD PMID:18164116 Cfdp1 Rat nitrates multiple interactions ISO Cfdp1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of CFDP1 mRNA CTD PMID:35964746 Cfdp1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CFDP1 mRNA CTD PMID:25729387 Cfdp1 Rat paracetamol increases expression ISO CFDP1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CFDP1 mRNA CTD PMID:26690555 Cfdp1 Rat pentachlorophenol increases expression ISO Cfdp1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of CFDP1 mRNA CTD PMID:23892564 Cfdp1 Rat potassium chromate decreases expression ISO CFDP1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of CFDP1 mRNA CTD PMID:22714537 Cfdp1 Rat rac-lactic acid decreases expression ISO CFDP1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CFDP1 mRNA CTD PMID:30851411 Cfdp1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CFDP1 mRNA CTD PMID:19013527 Cfdp1 Rat SB 431542 multiple interactions ISO CFDP1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CFDP1 mRNA CTD PMID:27188386 Cfdp1 Rat sodium arsenite decreases expression ISO Cfdp1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of CFDP1 mRNA CTD PMID:36209798 Cfdp1 Rat sunitinib decreases expression ISO CFDP1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of CFDP1 mRNA CTD PMID:31533062 Cfdp1 Rat tamoxifen affects expression ISO Cfdp1 (Mus musculus) 6480464 Tamoxifen affects the expression of CFDP1 mRNA CTD PMID:17555576 Cfdp1 Rat tetrachloromethane increases expression ISO Cfdp1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CFDP1 mRNA CTD PMID:31919559 Cfdp1 Rat thiram decreases expression ISO CFDP1 (Homo sapiens) 6480464 Thiram results in decreased expression of CFDP1 mRNA CTD PMID:38568856 Cfdp1 Rat titanium dioxide increases expression ISO Cfdp1 (Mus musculus) 6480464 titanium dioxide results in increased expression of CFDP1 mRNA CTD PMID:23131501 Cfdp1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CFDP1 mRNA CTD PMID:25729387 Cfdp1 Rat trichostatin A increases expression ISO CFDP1 (Homo sapiens) 6480464 trichostatin A results in increased expression of CFDP1 mRNA CTD PMID:24935251 Cfdp1 Rat triphenyl phosphate affects expression ISO CFDP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CFDP1 mRNA CTD PMID:37042841 Cfdp1 Rat valproic acid affects expression ISO CFDP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of CFDP1 mRNA CTD PMID:25979313 Cfdp1 Rat valproic acid increases expression ISO CFDP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CFDP1 mRNA CTD PMID:26272509 Cfdp1 Rat valproic acid multiple interactions ISO CFDP1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CFDP1 mRNA CTD PMID:27188386
1.
Cloning, gene expression, and characterization of CP27, a novel gene in mouse embryogenesis.
Diekwisch TG, etal., Gene 1999 Jul 22;235(1-2):19-30.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
GOA pipeline
RGD automated data pipeline
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Cfdp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 56,627,596 - 56,733,099 (-) NCBI GRCr8 mRatBN7.2 19 39,718,313 - 39,823,824 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 39,718,347 - 39,823,824 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 46,593,774 - 46,682,060 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 47,247,092 - 47,335,387 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 49,491,050 - 49,579,816 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 43,989,596 - 44,078,320 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 43,971,474 - 44,078,336 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 54,796,566 - 54,885,236 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 41,703,586 - 41,792,613 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 41,708,466 - 41,797,494 (-) NCBI Celera 19 39,095,820 - 39,183,251 (-) NCBI Celera Cytogenetic Map 19 q12 NCBI
CFDP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 75,293,710 - 75,433,503 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 75,293,698 - 75,433,503 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 75,327,608 - 75,467,401 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 73,885,109 - 74,024,888 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 73,885,108 - 74,024,888 NCBI Celera 16 59,621,931 - 59,761,694 (-) NCBI Celera Cytogenetic Map 16 q23.1 NCBI HuRef 16 61,078,149 - 61,219,205 (-) NCBI HuRef CHM1_1 16 76,740,054 - 76,879,720 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 81,340,442 - 81,479,377 (-) NCBI T2T-CHM13v2.0
Cfdp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 112,493,314 - 112,580,969 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 112,495,123 - 112,580,923 (-) Ensembl GRCm39 Ensembl GRCm38 8 111,766,682 - 111,854,337 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 111,768,491 - 111,854,291 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 114,292,373 - 114,378,210 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 114,655,146 - 114,740,983 (-) NCBI MGSCv36 mm8 Celera 8 115,996,901 - 116,082,919 (-) NCBI Celera Cytogenetic Map 8 E1 NCBI cM Map 8 57.98 NCBI
Cfdp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955484 2,085,379 - 2,203,177 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955484 2,085,372 - 2,203,177 (+) NCBI ChiLan1.0 ChiLan1.0
CFDP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 85,012,648 - 85,155,022 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 90,934,992 - 91,075,676 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 55,864,016 - 56,003,243 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 75,214,347 - 75,351,959 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 75,214,588 - 75,351,811 (-) Ensembl panpan1.1 panPan2
CFDP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 75,313,165 - 75,442,686 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 75,313,192 - 75,442,686 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 75,290,315 - 75,419,490 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 75,626,973 - 75,799,481 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 75,626,973 - 75,805,114 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 75,562,799 - 75,691,748 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 75,397,980 - 75,526,767 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 75,889,125 - 76,018,416 (+) NCBI UU_Cfam_GSD_1.0
Cfdp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 35,424,430 - 35,535,554 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 24,052,963 - 24,164,679 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 24,053,558 - 24,164,674 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CFDP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 12,223,748 - 12,354,177 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 12,223,701 - 12,354,180 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 12,077,068 - 12,196,905 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CFDP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 60,775,840 - 60,919,109 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 60,773,986 - 60,919,110 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 15,140,778 - 15,283,531 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cfdp1
.
Predicted Target Of
Count of predictions: 872 Count of miRNA genes: 329 Interacting mature miRNAs: 437 Transcripts: ENSRNOT00000026249 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 1358200 Insglur2 Insulin/glucose ratio QTL 2 4.1 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 19 33838214 55283146 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat
RH129513
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 39,734,425 - 39,734,638 (+) MAPPER mRatBN7.2 Rnor_6.0 19 43,987,889 - 43,988,101 NCBI Rnor6.0 Rnor_5.0 19 54,794,859 - 54,795,071 UniSTS Rnor5.0 RGSC_v3.4 19 41,701,879 - 41,702,091 UniSTS RGSC3.4 Celera 19 39,094,113 - 39,094,325 UniSTS RH 3.4 Map 19 491.1 UniSTS Cytogenetic Map 19 q12 UniSTS
RH144415
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 39,807,702 - 39,807,934 (+) MAPPER mRatBN7.2 mRatBN7.2 10 100,589,776 - 100,590,008 (-) MAPPER mRatBN7.2 mRatBN7.2 10 100,589,776 - 100,590,008 (+) MAPPER mRatBN7.2 mRatBN7.2 19 39,807,702 - 39,807,934 (-) MAPPER mRatBN7.2 Rnor_6.0 19 44,061,430 - 44,061,661 NCBI Rnor6.0 Rnor_6.0 10 103,899,382 - 103,899,613 NCBI Rnor6.0 Rnor_5.0 10 104,392,183 - 104,392,414 UniSTS Rnor5.0 Rnor_5.0 19 54,868,346 - 54,868,577 UniSTS Rnor5.0 RGSC_v3.4 19 41,776,075 - 41,776,306 UniSTS RGSC3.4 RGSC_v3.4 10 105,425,049 - 105,425,280 UniSTS RGSC3.4 Celera 10 99,165,062 - 99,165,293 UniSTS Celera 19 39,167,407 - 39,167,638 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 10 q32.3 UniSTS
BE110198
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 39,746,458 - 39,746,629 (+) MAPPER mRatBN7.2 Rnor_6.0 19 43,999,922 - 44,000,092 NCBI Rnor6.0 Rnor_5.0 19 54,806,892 - 54,807,062 UniSTS Rnor5.0 RGSC_v3.4 19 41,713,912 - 41,714,082 UniSTS RGSC3.4 Celera 19 39,106,171 - 39,106,341 UniSTS RH 3.4 Map 19 486.8 UniSTS Cytogenetic Map 19 q12 UniSTS
RH141174
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 6 198.5 UniSTS Cytogenetic Map 19 q12 UniSTS
BQ209669
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 39,735,418 - 39,735,612 (+) MAPPER mRatBN7.2 Rnor_6.0 19 43,988,883 - 43,989,076 NCBI Rnor6.0 Rnor_5.0 19 54,795,853 - 54,796,046 UniSTS Rnor5.0 RGSC_v3.4 19 41,702,873 - 41,703,066 UniSTS RGSC3.4 Celera 19 39,095,107 - 39,095,300 UniSTS RH 3.4 Map 19 486.8 UniSTS Cytogenetic Map 19 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026249 ⟹ ENSRNOP00000026249
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 39,736,117 - 39,823,780 (-) Ensembl Rnor_6.0 Ensembl 19 43,989,596 - 44,078,320 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089873 ⟹ ENSRNOP00000073816
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 39,718,347 - 39,823,747 (-) Ensembl Rnor_6.0 Ensembl 19 43,971,474 - 44,078,336 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112483 ⟹ ENSRNOP00000083789
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 39,734,313 - 39,823,824 (-) Ensembl
RefSeq Acc Id:
NM_199378 ⟹ NP_955410
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 56,643,592 - 56,733,098 (-) NCBI mRatBN7.2 19 39,734,312 - 39,823,824 (-) NCBI Rnor_6.0 19 43,989,596 - 44,078,320 (-) NCBI Rnor_5.0 19 54,796,566 - 54,885,236 (-) NCBI RGSC_v3.4 19 41,703,586 - 41,792,613 (-) RGD Celera 19 39,095,820 - 39,183,251 (-) RGD
Sequence:
GCTCCCCTCTAGGGCGGCCCTAGCTGCTGGTCCTGTACCTCTATGGTCTCGCCCTAGAGCTTCGCTATTTTGGGGCAGTGGCCGCAGTCGTGTTGGTAGCAGGCCCCAAGTGACAGCAGCATGGAAGA
hide sequence
RefSeq Acc Id:
XM_039097633 ⟹ XP_038953561
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 56,627,596 - 56,733,099 (-) NCBI mRatBN7.2 19 39,718,313 - 39,823,819 (-) NCBI
RefSeq Acc Id:
NP_955410 ⟸ NM_199378
- UniProtKB:
Q75UQ2 (UniProtKB/Swiss-Prot), A6IZB0 (UniProtKB/TrEMBL), A0A8L2QE45 (UniProtKB/TrEMBL)
- Sequence:
MEEFDSEDFSTSDEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQAEKTKGKRRKAQSIPARKRKQSGLLLDEEEDGEEDSGGSSREEDEEEQEGGLGSETSRKKKEDELWASFLNDVGTKSKAASSSQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000073816 ⟸ ENSRNOT00000089873
Ensembl Acc Id:
ENSRNOP00000026249 ⟸ ENSRNOT00000026249
RefSeq Acc Id:
XP_038953561 ⟸ XM_039097633
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K6H5 (UniProtKB/TrEMBL), A0A8L2QE45 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000083789 ⟸ ENSRNOT00000112483
RGD ID: 13701153 Promoter ID: EPDNEW_R11677 Type: initiation region Name: Cfdp1_1 Description: craniofacial development protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 44,078,322 - 44,078,382 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-08
Cfdp1
craniofacial development protein 1
Symbol and Name status set to approved
1299863 APPROVED
