Symbol:
Gkn1
Name:
gastrokine 1
RGD ID:
735014
Description:
Predicted to enable growth factor activity. Predicted to be involved in regulation of cell population proliferation. Predicted to act upstream of or within positive regulation of cell population proliferation. Predicted to be located in extracellular region and secretory granule. Predicted to be active in extracellular space. Orthologous to human GKN1 (gastrokine 1); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; beta-naphthoflavone; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Amp18; Ca11; Fov; foveolin; foveolin precursor; gastrokine-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GKN1 (gastrokine 1)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Gkn1 (gastrokine 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gkn1 (gastrokine 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GKN1 (gastrokine-1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GKN1 (gastrokine 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gkn1 (gastrokine 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GKN1 (gastrokine 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GKN1 (gastrokine 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GKN2 (gastrokine 2)
HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
GKN1 (gastrokine 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gkn1 (gastrokine 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gkn1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 121,347,417 - 121,352,705 (-) NCBI GRCr8 mRatBN7.2 4 119,790,101 - 119,795,389 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 119,790,101 - 119,795,389 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 125,261,663 - 125,267,030 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 121,036,416 - 121,041,783 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 119,660,661 - 119,666,028 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 119,143,070 - 119,148,358 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 119,143,070 - 119,148,358 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 183,711,680 - 183,717,243 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 121,496,151 - 121,501,439 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 121,740,631 - 121,745,920 (-) NCBI Celera 4 108,760,377 - 108,765,665 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Gkn1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 121,347,417 - 121,352,705 (-) NCBI GRCr8 mRatBN7.2 4 119,790,101 - 119,795,389 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 119,790,101 - 119,795,389 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 125,261,663 - 125,267,030 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 121,036,416 - 121,041,783 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 119,660,661 - 119,666,028 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 119,143,070 - 119,148,358 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 119,143,070 - 119,148,358 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 183,711,680 - 183,717,243 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 121,496,151 - 121,501,439 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 121,740,631 - 121,745,920 (-) NCBI Celera 4 108,760,377 - 108,765,665 (-) NCBI Celera Cytogenetic Map 4 q34 NCBI
GKN1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 68,974,636 - 68,980,976 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 68,974,573 - 68,980,980 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 69,201,768 - 69,208,108 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 69,055,209 - 69,061,616 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 69,113,417 - 69,119,763 NCBI Celera 2 69,052,436 - 69,058,843 (+) NCBI Celera Cytogenetic Map 2 p13.3 NCBI HuRef 2 68,937,927 - 68,944,334 (+) NCBI HuRef CHM1_1 2 69,131,023 - 69,137,429 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 68,987,051 - 68,993,391 (+) NCBI T2T-CHM13v2.0
Gkn1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 87,322,635 - 87,327,897 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 87,322,632 - 87,327,924 (-) Ensembl GRCm39 Ensembl GRCm38 6 87,345,653 - 87,350,915 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 87,345,650 - 87,350,942 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 87,295,647 - 87,300,909 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 87,311,287 - 87,316,549 (-) NCBI MGSCv36 mm8 Celera 6 89,284,666 - 89,289,929 (-) NCBI Celera Cytogenetic Map 6 D1 NCBI cM Map 6 37.96 NCBI
Gkn1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 16,046,662 - 16,049,687 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 16,046,662 - 16,051,235 (-) NCBI ChiLan1.0 ChiLan1.0
GKN1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 57,434,605 - 57,478,862 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 57,438,553 - 57,444,940 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 69,015,692 - 69,022,155 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 70,137,447 - 70,143,918 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 70,137,447 - 70,144,040 (+) Ensembl panpan1.1 panPan2
GKN1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 67,788,329 - 67,793,445 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 67,788,110 - 67,793,589 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 67,677,625 - 67,682,902 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 68,810,000 - 68,815,276 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 68,809,829 - 68,815,215 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 68,491,450 - 68,496,462 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 68,792,706 - 68,797,978 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 69,087,881 - 69,092,894 (+) NCBI UU_Cfam_GSD_1.0
Gkn1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 15,306,926 - 15,312,244 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936491 13,259,073 - 13,264,213 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936491 13,259,073 - 13,264,213 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GKN1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 73,420,359 - 73,426,592 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 73,420,359 - 73,426,472 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 76,861,574 - 76,867,686 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GKN1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 38,145,076 - 38,291,187 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 38,145,559 - 38,152,126 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 73,838,684 - 73,847,183 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 21 Count of miRNA genes: 20 Interacting mature miRNAs: 21 Transcripts: ENSRNOT00000012218 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 12798527 Anxrr58 Anxiety related response QTL 58 4.11 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 119463257 147278687 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
2
2
29
21
29
8
21
8
3
60
27
22
17
16
21
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012218 ⟹ ENSRNOP00000012218
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 119,790,101 - 119,795,389 (-) Ensembl Rnor_6.0 Ensembl 4 119,143,070 - 119,148,358 (-) Ensembl
RefSeq Acc Id:
NM_198972 ⟹ NP_945323
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 121,347,417 - 121,352,705 (-) NCBI mRatBN7.2 4 119,790,101 - 119,795,389 (-) NCBI Rnor_6.0 4 119,143,070 - 119,148,358 (-) NCBI Rnor_5.0 4 183,711,680 - 183,717,243 (-) NCBI RGSC_v3.4 4 121,496,151 - 121,501,439 (-) RGD Celera 4 108,760,377 - 108,765,665 (-) RGD
Sequence:
ATGCCTGCCTGCTCCTCCACTCCACCACTGCTGTCGACATGGGGTTCACAGTCCTCATCGTTGGTCTGCTCGGGCTCCTCGCAGCTCCTGGCTTTGCTTACACTATCAACATCAATGGTGACAGCAAT GTAGACGGAAGTGGACAGCAGTCGGTGAGCATCAACGGTGTGCACAACGTGGCCAATATTGACAACAATAACGGCTGGGACTCCTGGAACAGCCTCTGGGACTATGAAAATAGTTTTGCTGCAACGAG ACTCTTTGCCAAGAAATCATGCATTGTGCACAAAATGAATAAGGACGCCATGCCCTCCCTTCAGGACCTCGATACACTGGTCAAGCAGCAAAAGGGTAAAGGGCCCGAGGGAGCATCTCCCAAGGACT TGATGTACTCCATCAACCCTACCAGAGTGGAGGACGTGAATACATTCGGGCCGAAGATTGCTAGCATGTGCCGGGGCATCCCTACCTATGTGGCTGAGGAGATTCCAGGACCAAACCAGCCTTTGTAC TCAAAGAAGTGCTACACAGCTAACATACTCTGGATTCTGCGCATGTCCTTCTGTGAAACATCAGTGGAAACATACTAGAAGTCACAGAAAGACAAAATGTGGGCTCTGACCATTGCAATACCTAATTA TGAGAATGTTCTCGGAGAGTTATGATTAGCTTCTTTAAGGTTCAATAAACCCACCTGGCAGCACAA
hide sequence
RefSeq Acc Id:
NP_945323 ⟸ NM_198972
- Peptide Label:
precursor
- UniProtKB:
Q6SJV7 (UniProtKB/TrEMBL), F7ETE6 (UniProtKB/TrEMBL)
- Sequence:
MGFTVLIVGLLGLLAAPGFAYTININGDSNVDGSGQQSVSINGVHNVANIDNNNGWDSWNSLWDYENSFAATRLFAKKSCIVHKMNKDAMPSLQDLDTLVKQQKGKGPEGASPKDLMYSINPTRVEDV NTFGPKIASMCRGIPTYVAEEIPGPNQPLYSKKCYTANILWILRMSFCETSVETY
hide sequence
Ensembl Acc Id:
ENSRNOP00000012218 ⟸ ENSRNOT00000012218
RGD ID: 13693220
Promoter ID: EPDNEW_R3744
Type: multiple initiation site
Name: Gkn1_1
Description: gastrokine 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 119,148,358 - 119,148,418 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Gkn1
gastrokine 1
foveolin precursor
Name updated
1299863
APPROVED
2004-09-10
Gkn1
foveolin precursor
Fov
Symbol and Name updated
1299863
APPROVED