Advanced Search (OLGA)

Gene: Tenm2 (teneurin transmembrane protein 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Tenm2

Name:

teneurin transmembrane protein 2

RGD ID:

727907

Description:

Enables cell adhesion molecule binding activity and signaling receptor binding activity. Predicted to be involved in several processes, including negative regulation of transcription by RNA polymerase II; positive regulation of filopodium assembly; and retrograde trans-synaptic signaling by trans-synaptic protein complex. Located in dendritic spine and postsynaptic membrane. Is active in glutamatergic synapse. Is extrinsic component of postsynaptic membrane. Orthologous to human TENM2 (teneurin transmembrane protein 2); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Lasso; LOC102551468; neurestin; odd Oz/ten-m homolog 2; odd Oz/ten-m homolog 2 (Drosophila); odz, odd Oz/ten-m homolog 2; odz, odd Oz/ten-m homolog 2 (Drosophila); Odz2; ten-2; ten-m2; tenascin-M2; teneurin-2; teneurin-2-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TENM2 (teneurin transmembrane protein 2)	HGNC	Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Tenm2 (teneurin transmembrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tenm2 (teneurin transmembrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TENM2 (teneurin transmembrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TENM2 (teneurin transmembrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tenm2 (teneurin transmembrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TENM2 (teneurin transmembrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TENM2 (teneurin transmembrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tenm2 (teneurin transmembrane protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRIM7 (tripartite motif containing 7)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TENM2 (teneurin transmembrane protein 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tenm2 (teneurin transmembrane protein 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-34l15.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ten-a	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ten-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ten-m	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	20,984,710 - 22,121,001 (-)	NCBI		GRCr8
mRatBN7.2	10	20,480,662 - 21,706,415 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	20,481,854 - 21,705,597 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	25,229,591 - 26,365,979 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	24,718,139 - 25,854,542 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	20,205,571 - 21,341,852 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	20,846,091 - 21,791,771 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	20,844,899 - 21,265,026 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	20,716,458 - 21,659,087 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	20,939,207 - 21,888,443 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	20,940,255 - 22,096,609 (-)	NCBI
Celera	10	20,101,901 - 21,233,134 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tenm2	Rat	esophageal atresia		ISO	TENM2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Esophageal atresia	ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tenm2	Rat	substance-related disorder		ISO	TENM2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:20098672

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tenm2	Rat	(-)-demecolcine	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Demecolcine results in increased expression of TENM2 mRNA	CTD	PMID:23649840
Tenm2	Rat	17beta-estradiol	affects expression	ISO	TENM2 (Homo sapiens)	6480464	Estradiol affects the expression of TENM2 mRNA	CTD	PMID:22574217
Tenm2	Rat	17beta-estradiol	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[Estradiol co-treated with TGFB1 protein] results in increased expression of TENM2 mRNA	CTD	PMID:30165855
Tenm2	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	EXP		6480464	2 more ...	CTD	PMID:27291303
Tenm2	Rat	2,2',5,5'-tetrachlorobiphenyl	increases expression	ISO	TENM2 (Homo sapiens)	6480464	2 more ...	CTD	PMID:36804509
Tenm2	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	TENM2 (Homo sapiens)	6480464	bisphenol S results in decreased methylation of TENM2 gene	CTD	PMID:31601247
Tenm2	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Tenm2 (Mus musculus)	6480464	bisphenol S affects the methylation of TENM2 gene	CTD	PMID:31683443
Tenm2	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of TENM2 mRNA	CTD	PMID:24780913
Tenm2	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of TENM2 mRNA	CTD	PMID:31881176
Tenm2	Rat	aflatoxin B1	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of TENM2 mRNA	CTD	PMID:27153756 and PMID:32234424
Tenm2	Rat	aflatoxin B1	increases methylation	ISO	TENM2 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of TENM2 exon more ...	CTD	PMID:27153756 and PMID:30157460
Tenm2	Rat	Aflatoxin B2 alpha	decreases methylation	ISO	TENM2 (Homo sapiens)	6480464	aflatoxin B2 results in decreased methylation of TENM2 intron	CTD	PMID:30157460
Tenm2	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of TENM2 mRNA	CTD	PMID:16483693
Tenm2	Rat	aristolochic acid A	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of TENM2 mRNA	CTD	PMID:33212167
Tenm2	Rat	arsane	affects methylation	ISO	TENM2 (Homo sapiens)	6480464	Arsenic affects the methylation of TENM2 gene	CTD	PMID:25304211
Tenm2	Rat	arsane	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TENM2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TENM2 mRNA	CTD	PMID:39836092
Tenm2	Rat	arsenic atom	affects methylation	ISO	TENM2 (Homo sapiens)	6480464	Arsenic affects the methylation of TENM2 gene	CTD	PMID:25304211
Tenm2	Rat	arsenic atom	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TENM2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TENM2 mRNA	CTD	PMID:39836092
Tenm2	Rat	arsenous acid	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of TENM2 mRNA	CTD	PMID:20458559
Tenm2	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of TENM2 gene	CTD	PMID:35440735
Tenm2	Rat	benzo[a]pyrene	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of TENM2 mRNA	CTD	PMID:20106945
Tenm2	Rat	benzo[a]pyrene	decreases expression	ISO	Tenm2 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of TENM2 mRNA	CTD	PMID:32417428
Tenm2	Rat	benzo[a]pyrene	affects methylation	ISO	TENM2 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of TENM2 exon and Benzo(a)pyrene affects the methylation of TENM2 intron	CTD	PMID:30157460
Tenm2	Rat	benzo[a]pyrene	affects methylation	ISO	Tenm2 (Mus musculus)	6480464	Benzo(a)pyrene affects the methylation of TENM2 intron	CTD	PMID:27901495
Tenm2	Rat	benzo[a]pyrene	decreases methylation	ISO	TENM2 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of TENM2 promoter	CTD	PMID:27901495
Tenm2	Rat	benzo[a]pyrene	decreases methylation	ISO	Tenm2 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased methylation of TENM2 exon	CTD	PMID:27901495
Tenm2	Rat	beta-naphthoflavone	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of TENM2 mRNA	CTD	PMID:18164116
Tenm2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TENM2 mRNA	CTD	PMID:25181051
Tenm2	Rat	bisphenol A	increases methylation	ISO	TENM2 (Homo sapiens)	6480464	bisphenol A results in increased methylation of TENM2 gene	CTD	PMID:31601247
Tenm2	Rat	bisphenol A	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] affects the methylation of TENM2 gene	CTD	PMID:31601247
Tenm2	Rat	bisphenol A	increases expression	ISO	Tenm2 (Mus musculus)	6480464	bisphenol A results in increased expression of TENM2 mRNA	CTD	PMID:30245210
Tenm2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of TENM2 mRNA	CTD	PMID:30816183 and PMID:34947998
Tenm2	Rat	bisphenol A	decreases expression	ISO	Tenm2 (Mus musculus)	6480464	bisphenol A results in decreased expression of TENM2 mRNA	CTD	PMID:30951980 and PMID:32156529
Tenm2	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of TENM2 gene	CTD	PMID:28505145
Tenm2	Rat	bisphenol A	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	bisphenol A results in decreased expression of TENM2 mRNA	CTD	PMID:27685785
Tenm2	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Testosterone] results in decreased expression of TENM2 mRNA	CTD	PMID:26496021
Tenm2	Rat	bisphenol A	increases expression	ISO	TENM2 (Homo sapiens)	6480464	bisphenol A results in increased expression of TENM2 mRNA	CTD	PMID:18007998
Tenm2	Rat	bisphenol F	decreases expression	ISO	Tenm2 (Mus musculus)	6480464	bisphenol F results in decreased expression of TENM2 mRNA	CTD	PMID:30951980
Tenm2	Rat	bromobenzene	decreases expression	EXP		6480464	bromobenzene results in decreased expression of TENM2 mRNA	CTD	PMID:32479839
Tenm2	Rat	cannabidiol	increases methylation	ISO	Tenm2 (Mus musculus)	6480464	Cannabidiol results in increased methylation of TENM2 gene	CTD	PMID:32579259
Tenm2	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of TENM2 mRNA	CTD	PMID:18668222
Tenm2	Rat	chromium(6+)	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of TENM2 mRNA	CTD	PMID:38479592
Tenm2	Rat	chrysene	increases expression	ISO	Tenm2 (Mus musculus)	6480464	chrysene results in increased expression of TENM2 mRNA	CTD	PMID:26377693
Tenm2	Rat	cocaine	affects expression	EXP		6480464	Cocaine affects the expression of TENM2 mRNA	CTD	PMID:20187946
Tenm2	Rat	cocaine	decreases expression	EXP		6480464	Cocaine results in decreased expression of TENM2 mRNA	CTD	PMID:17898221
Tenm2	Rat	cyclosporin A	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Cyclosporine results in increased expression of TENM2 mRNA	CTD	PMID:20106945
Tenm2	Rat	dexamethasone	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	Dexamethasone results in decreased expression of TENM2 mRNA	CTD	PMID:25047013
Tenm2	Rat	diarsenic trioxide	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of TENM2 mRNA	CTD	PMID:20458559
Tenm2	Rat	dorsomorphin	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Tenm2	Rat	doxorubicin	affects methylation	EXP		6480464	Doxorubicin affects the methylation of TENM2 gene	CTD	PMID:28962528
Tenm2	Rat	doxorubicin	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of TENM2 mRNA	CTD	PMID:29803840
Tenm2	Rat	ethanol	affects splicing	ISO	Tenm2 (Mus musculus)	6480464	Ethanol affects the splicing of TENM2 mRNA	CTD	PMID:30319688
Tenm2	Rat	ethanol	increases expression	ISO	Tenm2 (Mus musculus)	6480464	Ethanol results in increased expression of TENM2 mRNA	CTD	PMID:30319688
Tenm2	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of TENM2 mRNA	CTD	PMID:30307764
Tenm2	Rat	formaldehyde	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Formaldehyde results in increased expression of TENM2 mRNA	CTD	PMID:23649840 and PMID:28937961
Tenm2	Rat	fulvestrant	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] affects the methylation of TENM2 gene	CTD	PMID:31601247
Tenm2	Rat	genistein	increases expression	ISO	Tenm2 (Mus musculus)	6480464	Genistein results in increased expression of TENM2 mRNA	CTD	PMID:32186404
Tenm2	Rat	Heliotrine	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	heliotrine results in decreased expression of TENM2 mRNA	CTD	PMID:26100227
Tenm2	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of TENM2 mRNA	CTD	PMID:21396975
Tenm2	Rat	manganese atom	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TENM2 mRNA	CTD	PMID:39836092
Tenm2	Rat	manganese(0)	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TENM2 mRNA	CTD	PMID:39836092
Tenm2	Rat	manganese(II) chloride	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TENM2 mRNA	CTD	PMID:39836092
Tenm2	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of TENM2 gene	CTD	PMID:35440735
Tenm2	Rat	methylmercury chloride	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of TENM2 mRNA	CTD	PMID:28001369
Tenm2	Rat	Muraglitazar	increases expression	EXP		6480464	muraglitazar results in increased expression of TENM2 mRNA	CTD	PMID:21515302
Tenm2	Rat	N,N-diethyl-m-toluamide	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] affects the methylation of TENM2 gene	CTD	PMID:33148267
Tenm2	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of TENM2 mRNA	CTD	PMID:18164116
Tenm2	Rat	N-nitrosodiethylamine	multiple interactions	ISO	Tenm2 (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of TENM2 gene	CTD	PMID:23968726
Tenm2	Rat	O-methyleugenol	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	methyleugenol results in decreased expression of TENM2 mRNA	CTD	PMID:32234424
Tenm2	Rat	orphenadrine	affects expression	EXP		6480464	Orphenadrine affects the expression of TENM2 mRNA	CTD	PMID:23665939
Tenm2	Rat	panobinostat	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TENM2 mRNA	CTD	PMID:27188386
Tenm2	Rat	panobinostat	increases expression	ISO	TENM2 (Homo sapiens)	6480464	panobinostat results in increased expression of TENM2 mRNA	CTD	PMID:26272509
Tenm2	Rat	permethrin	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] affects the methylation of TENM2 gene	CTD	PMID:33148267
Tenm2	Rat	phenylmercury acetate	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Phenylmercuric Acetate results in increased expression of TENM2 mRNA	CTD	PMID:26272509
Tenm2	Rat	phenylmercury acetate	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TENM2 mRNA	CTD	PMID:27188386
Tenm2	Rat	piperonyl butoxide	multiple interactions	ISO	Tenm2 (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of TENM2 gene	CTD	PMID:23968726
Tenm2	Rat	pirinixic acid	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of TENM2 mRNA	CTD	PMID:19710929
Tenm2	Rat	potassium chromate	increases expression	ISO	TENM2 (Homo sapiens)	6480464	potassium chromate(VI) results in increased expression of TENM2 mRNA	CTD	PMID:22714537
Tenm2	Rat	potassium dichromate	decreases expression	ISO	Tenm2 (Mus musculus)	6480464	Potassium Dichromate results in decreased expression of TENM2 mRNA	CTD	PMID:23608068
Tenm2	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of TENM2 mRNA	CTD	PMID:28374803
Tenm2	Rat	SB 431542	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Tenm2	Rat	senecionine	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	senecionine results in decreased expression of TENM2 mRNA	CTD	PMID:26100227
Tenm2	Rat	Senkirkine	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	senkirkine results in decreased expression of TENM2 mRNA	CTD	PMID:26100227
Tenm2	Rat	sodium arsenite	affects methylation	ISO	TENM2 (Homo sapiens)	6480464	sodium arsenite affects the methylation of TENM2 gene	CTD	PMID:28589171
Tenm2	Rat	sodium arsenite	decreases expression	ISO	Tenm2 (Mus musculus)	6480464	sodium arsenite results in decreased expression of TENM2 mRNA	CTD	PMID:36209798 and PMID:37682722
Tenm2	Rat	sodium arsenite	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TENM2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TENM2 mRNA	CTD	PMID:39836092
Tenm2	Rat	sunitinib	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Sunitinib results in increased expression of TENM2 mRNA	CTD	PMID:31533062
Tenm2	Rat	Tesaglitazar	increases expression	EXP		6480464	tesaglitazar results in increased expression of TENM2 mRNA	CTD	PMID:21515302
Tenm2	Rat	testosterone	multiple interactions	EXP		6480464	[bisphenol A co-treated with Testosterone] results in decreased expression of TENM2 mRNA	CTD	PMID:26496021
Tenm2	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of TENM2 mRNA	CTD	PMID:34492290
Tenm2	Rat	toxaphene	affects response to substance	ISO	TENM2 (Homo sapiens)	6480464	TENM2 gene SNP affects the susceptibility to Toxaphene	CTD	PMID:25622337
Tenm2	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of TENM2 mRNA	CTD	PMID:33387578
Tenm2	Rat	trichostatin A	increases expression	ISO	TENM2 (Homo sapiens)	6480464	trichostatin A results in increased expression of TENM2 mRNA	CTD	PMID:24935251 and PMID:26272509
Tenm2	Rat	trichostatin A	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TENM2 mRNA	CTD	PMID:27188386
Tenm2	Rat	triclosan	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Triclosan results in increased expression of TENM2 mRNA	CTD	PMID:30510588
Tenm2	Rat	triptonide	increases expression	ISO	Tenm2 (Mus musculus)	6480464	triptonide results in increased expression of TENM2 mRNA	CTD	PMID:33045310
Tenm2	Rat	valproic acid	decreases expression	ISO	TENM2 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of TENM2 mRNA	CTD	PMID:29154799
Tenm2	Rat	valproic acid	multiple interactions	ISO	TENM2 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TENM2 mRNA	CTD	PMID:27188386
Tenm2	Rat	valproic acid	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Valproic Acid results in increased expression of TENM2 mRNA	CTD	PMID:19101580 more ...
Tenm2	Rat	valproic acid	affects expression	ISO	TENM2 (Homo sapiens)	6480464	Valproic Acid affects the expression of TENM2 mRNA	CTD	PMID:25979313
Tenm2	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of TENM2 mRNA	CTD	PMID:19015723
Tenm2	Rat	vincristine	increases expression	ISO	TENM2 (Homo sapiens)	6480464	Vincristine results in increased expression of TENM2 mRNA	CTD	PMID:23649840

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tenm2	Rat	cell adhesion	involved_in	IEA	UniProtKB-KW:KW-0130	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	cell-cell adhesion	involved_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	neuron development	involved_in	IBA	PANTHER:PTN000131466 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tenm2	Rat	positive regulation of filopodium assembly	involved_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	retrograde trans-synaptic signaling by trans-synaptic protein complex	involved_in	ISO	TENM2 (Homo sapiens)	1624291	PMID:21724987	RGD	PMID:21724987
Tenm2	Rat	retrograde trans-synaptic signaling by trans-synaptic protein complex	involved_in	IEA	UniProtKB:Q9NT68 and ensembl:ENSP00000429430	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tenm2	Rat	signal transduction	involved_in	IEA	InterPro:IPR009471	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tenm2	Rat	cell junction	located_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	cell projection	located_in	IEA	UniProtKB-SubCell:SL-0280	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	cell-cell junction	located_in	ISS	UniProtKB:Q9NT68-2	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	cell-cell junction	located_in	ISO	TENM2 (Homo sapiens) and UniProtKB:Q9NT68-2	1624291	PMID:21724987	RGD	PMID:21724987
Tenm2	Rat	dendrite	located_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	dendritic spine	located_in	IDA		8553824	PMID:21724987	UniProt
Tenm2	Rat	dendritic spine	located_in	IEA	UniProtKB-SubCell:SL-0284	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0095	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	endoplasmic reticulum	located_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	extrinsic component of postsynaptic membrane	is_active_in	IDA		8553824	PMID:21724987	SynGO
Tenm2	Rat	extrinsic component of postsynaptic membrane	is_active_in	IEP		8553824	PMID:21724987	SynGO
Tenm2	Rat	extrinsic component of postsynaptic membrane	is_active_in	IMP		8553824	PMID:21724987	SynGO
Tenm2	Rat	filopodium	located_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	filopodium	located_in	IEA	UniProtKB-SubCell:SL-0286	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	glutamatergic synapse	is_active_in	IDA		8553824	PMID:21724987	SynGO
Tenm2	Rat	glutamatergic synapse	is_active_in	IEP		8553824	PMID:21724987	SynGO
Tenm2	Rat	glutamatergic synapse	is_active_in	IMP		8553824	PMID:21724987	SynGO
Tenm2	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	Golgi apparatus	located_in	IEA	UniProtKB-SubCell:SL-0132	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	Golgi apparatus	located_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	growth cone	located_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	growth cone	located_in	IEA	UniProtKB-SubCell:SL-0288	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	membrane	located_in	IEA	InterPro:IPR009471	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tenm2	Rat	neuron projection	located_in	IDA		8553824	PMID:21724987	UniProt
Tenm2	Rat	neuron projection	located_in	IEA	UniProtKB-KW:KW-0771	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	neuron projection	is_active_in	IBA	MGI:2447063 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tenm2	Rat	nucleus	located_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	plasma membrane	located_in	ISO	TENM2 (Homo sapiens) and UniProtKB:Q9NT68-2	1624291	PMID:21724987	RGD	PMID:21724987
Tenm2	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	plasma membrane	located_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	plasma membrane	located_in	IDA		8553824	PMID:21724987	UniProt
Tenm2	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	PML body	located_in	ISS	UniProtKB:Q9DER5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	PML body	located_in	IEA	UniProtKB-SubCell:SL-0465	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	postsynaptic membrane	located_in	IDA		8553824	PMID:21724987	UniProt
Tenm2	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-SubCell:SL-0219	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-KW:KW-0628	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	synapse	located_in	IEA	GO:0098942	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Tenm2	Rat	synapse	located_in	IEA	UniProtKB-SubCell:SL-0258	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tenm2	Rat	synapse	located_in	IEA	UniProtKB-KW:KW-0770	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tenm2	Rat	synapse	located_in	IDA		8553824	PMID:21724987	UniProt

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tenm2	Rat	calcium ion binding	enables	IEA	InterPro:IPR001881	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tenm2	Rat	cell adhesion molecule binding	enables	IDA		8553824	PMID:21724987	UniProt
Tenm2	Rat	cell adhesion molecule binding	enables	IBA	PANTHER:PTN000131466 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tenm2	Rat	cell adhesion molecule binding	enables	ISO	TENM2 (Homo sapiens) and UniProtKB:Q9NT68-2	1624291	PMID:21724987	RGD	PMID:21724987
Tenm2	Rat	identical protein binding	enables	ISO	Tenm2 (Mus musculus)	1624291	PR:Q9WTS5 PMID:12000766	RGD	PMID:12000766
Tenm2	Rat	protein binding	enables	IPI	UniProtKB:O88917-2	8553824	PMID:21724987	UniProt
Tenm2	Rat	protein binding	enables	ISO	Tenm2 (Mus musculus)	1624291	PR:Q9WTS4 more ...	RGD	PMID:12000766
Tenm2	Rat	protein binding	enables	ISO	TENM2 (Homo sapiens) and UniProtKB:Q9NT68-2	1624291	UniProtKB:O88917-2 and PMID:21724987	RGD	PMID:21724987
Tenm2	Rat	protein heterodimerization activity	enables	ISS	UniProtKB:Q9WTS5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	protein heterodimerization activity	enables	ISO	Tenm2 (Mus musculus)	1624291	PMID:12000766	RGD	PMID:12000766
Tenm2	Rat	protein heterodimerization activity	enables	IBA	MGI:1345183 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tenm2	Rat	protein homodimerization activity	enables	ISS	UniProtKB:Q9WTS5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tenm2	Rat	protein homodimerization activity	enables	IBA	MGI:1345184 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tenm2	Rat	protein homodimerization activity	enables	ISO	Tenm2 (Mus musculus)	1624291	PMID:12000766	RGD	PMID:12000766
Tenm2	Rat	signaling receptor binding	enables	ISO	TENM2 (Homo sapiens) and UniProtKB:Q9NT68-2	1624291	PMID:21724987	RGD	PMID:21724987
Tenm2	Rat	signaling receptor binding	enables	IDA		8553824	PMID:21724987	UniProt

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	Neurestin: putative transmembrane molecule implicated in neuronal development.	Otaki JM and Firestein S, Dev Biol 1999 Aug 1;212(1):165-81.
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Latrophilin 1 and its endogenous ligand Lasso/teneurin-2 form a high-affinity transsynaptic receptor pair with signaling capabilities.	Silva JP, etal., Proc Natl Acad Sci U S A. 2011 Jul 19;108(29):12113-8. doi: 10.1073/pnas.1019434108. Epub 2011 Jul 1.

PMID:12000766

Tenm2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	20,984,710 - 22,121,001 (-)	NCBI		GRCr8
mRatBN7.2	10	20,480,662 - 21,706,415 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	20,481,854 - 21,705,597 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	25,229,591 - 26,365,979 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	24,718,139 - 25,854,542 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	20,205,571 - 21,341,852 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	20,846,091 - 21,791,771 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	20,844,899 - 21,265,026 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	20,716,458 - 21,659,087 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	20,939,207 - 21,888,443 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	20,940,255 - 22,096,609 (-)	NCBI
Celera	10	20,101,901 - 21,233,134 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

TENM2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	166,979,029 - 168,264,157 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	166,979,029 - 168,264,157 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	166,406,034 - 167,691,162 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	167,114,519 - 167,623,740 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	167,477,951 - 167,623,739	NCBI
Celera	5	162,750,499 - 163,726,534 (+)	NCBI		Celera
Cytogenetic Map	5	q34	NCBI
HuRef	5	161,812,425 - 162,791,103 (+)	NCBI		HuRef
CHM1_1	5	166,144,311 - 167,124,193 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	167,513,669 - 168,798,988 (+)	NCBI		T2T-CHM13v2.0

Tenm2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	35,897,483 - 37,881,486 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	35,897,483 - 37,126,791 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	36,006,656 - 37,237,053 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	36,006,656 - 37,235,964 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	35,820,171 - 36,757,745 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	35,851,071 - 36,787,666 (-)	NCBI		MGSCv36	mm8
Celera	11	40,009,205 - 40,811,666 (-)	NCBI		Celera
Cytogenetic Map	11	A4- A5	NCBI
cM Map	11	21.96	NCBI

Tenm2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	20,437,067 - 21,338,897 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	20,150,223 - 21,340,276 (+)	NCBI	ChiLan1.0	ChiLan1.0

TENM2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	160,186,848 - 163,424,969 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	158,326,399 - 161,564,515 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	162,346,710 - 163,627,371 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	169,420,475 - 170,392,593 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	169,420,480 - 170,392,581 (+)	Ensembl	panpan1.1		panPan2

TENM2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	43,450,278 - 44,962,993 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	43,451,059 - 44,377,371 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	43,408,748 - 44,060,223 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	43,873,657 - 44,519,117 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	43,874,738 - 44,793,811 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	43,643,674 - 44,287,381 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	43,838,128 - 44,482,532 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	44,344,597 - 44,989,412 (-)	NCBI		UU_Cfam_GSD_1.0

Tenm2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	97,485,971 - 98,368,217 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936622	1,102,963 - 1,983,751 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936622	1,101,587 - 1,983,816 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TENM2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	55,625,320 - 56,620,257 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	55,624,273 - 59,084,150 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	60,189,355 - 61,223,392 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TENM2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	69,206,076 - 70,487,159 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666034	8,199,738 - 9,519,849 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tenm2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	21,732,787 - 22,627,526 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	21,732,997 - 22,921,889 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tenm2
8261 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	302
Count of miRNA genes:	115
Interacting mature miRNAs:	125
Transcripts:	ENSRNOT00000011922, ENSRNOT00000068312
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	29497586	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat

D10Mit5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	10	21,523,906 - 21,524,070	NCBI	Rnor6.0
Rnor_5.0	10	21,392,295 - 21,392,459	UniSTS	Rnor5.0
RGSC_v3.4	10	21,607,719 - 21,607,865	RGD	RGSC3.4
RGSC_v3.4	10	21,607,720 - 21,607,865	UniSTS	RGSC3.4
RGSC_v3.1	10	21,608,769 - 21,608,914	RGD
RH 3.4 Map	10	240.41	UniSTS
RH 3.4 Map	10	240.41	RGD
RH 2.0 Map	10	246.1	RGD
Cytogenetic Map	10	q12	UniSTS

D10Rat42

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	21,833,758 - 21,833,887 (+)	Marker Load Pipeline
mRatBN7.2	10	21,329,805 - 21,330,072 (+)	MAPPER	mRatBN7.2
mRatBN7.2	10	21,329,805 - 21,329,934 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	21,707,766 - 21,708,067	NCBI	Rnor6.0
Rnor_6.0	10	21,707,766 - 21,707,894	NCBI	Rnor6.0
Rnor_5.0	10	21,575,051 - 21,575,352	UniSTS	Rnor5.0
Rnor_5.0	10	21,575,051 - 21,575,179	UniSTS	Rnor5.0
RH 3.4 Map	10	240.11	RGD
RH 3.4 Map	10	240.11	UniSTS
RH 2.0 Map	10	251.9	RGD
SHRSP x BN Map	10	27.23	RGD
FHH x ACI Map	10	15.2	RGD
Cytogenetic Map	10	q12	UniSTS

D10Rat75

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	21,280,441 - 21,280,573 (+)	Marker Load Pipeline
mRatBN7.2	10	20,776,430 - 20,776,562 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	21,140,054 - 21,140,185	NCBI	Rnor6.0
Rnor_5.0	10	21,008,287 - 21,008,418	UniSTS	Rnor5.0
RGSC_v3.4	10	21,235,991 - 21,236,123	RGD	RGSC3.4
RGSC_v3.4	10	21,235,992 - 21,236,123	UniSTS	RGSC3.4
RGSC_v3.1	10	21,237,040 - 21,237,172	RGD
Celera	10	20,395,511 - 20,395,642	UniSTS
SHRSP x BN Map	10	26.1499	UniSTS
SHRSP x BN Map	10	26.1499	RGD
Cytogenetic Map	10	q12	UniSTS

D10Rat179

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	10	21,236,996 - 21,237,161	NCBI	Rnor6.0
Rnor_5.0	10	21,105,195 - 21,105,360	UniSTS	Rnor5.0
RGSC_v3.4	10	21,332,818 - 21,333,025	RGD	RGSC3.4
RGSC_v3.4	10	21,332,819 - 21,333,025	UniSTS	RGSC3.4
RGSC_v3.1	10	21,333,867 - 21,334,074	RGD
Celera	10	20,491,739 - 20,491,934	UniSTS
SHRSP x BN Map	10	27.31	UniSTS
SHRSP x BN Map	10	27.31	RGD
Cytogenetic Map	10	q12	UniSTS

D11Mit232

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	20,526,569 - 20,526,750 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	20,890,843 - 20,891,023	NCBI	Rnor6.0
Rnor_5.0	10	20,761,210 - 20,761,390	UniSTS	Rnor5.0
RGSC_v3.4	10	20,983,922 - 20,984,102	UniSTS	RGSC3.4
Celera	10	20,146,552 - 20,146,719	UniSTS
Cytogenetic Map	10	q12	UniSTS

BE102452

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	20,499,028 - 20,499,194 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	20,863,306 - 20,863,471	NCBI	Rnor6.0
Rnor_5.0	10	20,733,673 - 20,733,838	UniSTS	Rnor5.0
RGSC_v3.4	10	20,956,384 - 20,956,549	UniSTS	RGSC3.4
Celera	10	20,119,074 - 20,119,239	UniSTS
RH 3.4 Map	10	214.33	UniSTS
Cytogenetic Map	10	q12	UniSTS

RH138576

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	20,481,529 - 20,481,726 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	20,845,767 - 20,845,963	NCBI	Rnor6.0
Rnor_5.0	10	20,716,134 - 20,716,330	UniSTS	Rnor5.0
RGSC_v3.4	10	20,938,883 - 20,939,079	UniSTS	RGSC3.4
Celera	10	20,101,577 - 20,101,773	UniSTS
RH 3.4 Map	10	215.72	UniSTS
Cytogenetic Map	10	q12	UniSTS

D3Bwg1534e

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	20,481,842 - 20,482,055 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	20,846,080 - 20,846,292	NCBI	Rnor6.0
Rnor_5.0	10	20,716,447 - 20,716,659	UniSTS	Rnor5.0
RGSC_v3.4	10	20,939,196 - 20,939,408	UniSTS	RGSC3.4
Celera	10	20,101,890 - 20,102,102	UniSTS
Cytogenetic Map	10	q12	UniSTS

RH144521

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	21,139,330 - 21,139,514 (+)	Marker Load Pipeline
mRatBN7.2	10	20,635,298 - 20,635,482 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	22,105,801 - 22,105,984	NCBI	Rnor6.0
Rnor_6.0	10	20,998,936 - 20,999,119	NCBI	Rnor6.0
Rnor_5.0	10	20,866,384 - 20,866,567	UniSTS	Rnor5.0
Rnor_5.0	10	21,971,053 - 21,971,236	UniSTS	Rnor5.0
RGSC_v3.4	10	21,093,062 - 21,093,245	UniSTS	RGSC3.4
Celera	10	20,254,868 - 20,255,051	UniSTS
RH 3.4 Map	10	241.11	UniSTS
Cytogenetic Map	10	q12	UniSTS

BE096193

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	21,131,025 - 21,131,224 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	21,507,177 - 21,507,375	NCBI	Rnor6.0
Rnor_5.0	10	21,375,566 - 21,375,764	UniSTS	Rnor5.0
RGSC_v3.4	10	21,591,079 - 21,591,277	UniSTS	RGSC3.4
Celera	10	20,748,252 - 20,748,450	UniSTS
RH 3.4 Map	10	239.4	UniSTS
Cytogenetic Map	10	q12	UniSTS

AI501498

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	20,949,883 - 20,950,071 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	21,314,944 - 21,315,131	NCBI	Rnor6.0
Rnor_5.0	10	21,182,663 - 21,182,850	UniSTS	Rnor5.0
RGSC_v3.4	10	21,410,540 - 21,410,727	UniSTS	RGSC3.4
Celera	10	20,568,102 - 20,568,289	UniSTS
RH 3.4 Map	10	235.7	UniSTS
Cytogenetic Map	10	q12	UniSTS

AW529537

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	21,044,921 - 21,045,131 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	21,420,490 - 21,420,699	NCBI	Rnor6.0
Rnor_5.0	10	21,287,635 - 21,287,844	UniSTS	Rnor5.0
Celera	10	20,662,181 - 20,662,390	UniSTS
RH 3.4 Map	10	241.7	UniSTS
Cytogenetic Map	10	q12	UniSTS

AU049925

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	21,330,407 - 21,330,599 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	21,708,541 - 21,708,732	NCBI	Rnor6.0
Rnor_5.0	10	21,575,826 - 21,576,017	UniSTS	Rnor5.0
RGSC_v3.4	10	21,791,994 - 21,792,185	UniSTS	RGSC3.4
Celera	10	20,947,151 - 20,947,312	UniSTS
Cytogenetic Map	10	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	38	113	87	86	55	25	55	6	201	85	93	44	60	31


RefSeq Transcripts	NM_020088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268320	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF086607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF086608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF086609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF086610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011922 ⟹ ENSRNOP00000011922

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	20,481,854 - 21,705,597 (-)	Ensembl
Rnor_6.0 Ensembl	10	20,844,899 - 21,265,026 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097791 ⟹ ENSRNOP00000077386

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	20,481,854 - 21,705,597 (-)	Ensembl

RefSeq Acc Id:

NM_020088 ⟹ NP_064473

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,985,902 - 22,120,940 (-)	NCBI
mRatBN7.2	10	20,481,854 - 21,617,003 (-)	NCBI
Rnor_6.0	10	20,846,091 - 21,791,771 (-)	NCBI
Rnor_5.0	10	20,716,458 - 21,659,087 (-)	NCBI
RGSC_v3.4	10	20,939,207 - 21,888,443 (-)	RGD
Celera	10	20,101,901 - 21,233,134 (-)	RGD

Sequence:

show sequence

GTGAGCATTCCCGGAAACGCAGCTGAGTTGTTGGACAACAGACGTCCACCCAGTCGGTGGGTAAAGTGACAGGTGCCACAACTCCAGCCTCCCCTTTTCTGAAAGTCGCGGAGTTCCATTTCATCTGC
AATAATGGATGTGAAGGATCGGCGACATCGCTCTTTGACCAGGGGACGGTGTGGCAAGGAGTGTCGCTACACCAGCTCCTCTCTGGACAGTGAGGACTGCCGTGTGCCCACGCAGAAGTCCTACAGTT
CCAGTGAGACCCTGAAGGCTTATGACCATGACAGCAGAATGCACTATGGAAACCGAGTCACAGACCTGGTGCACCGGGAGTCCGATGAGTTTTCTAGACAAGGGGCTAATTTCACCCTGGCAGAATTG
GGAATCTGCGAGCCCTCCCCACACCGAAGTGGTTACTGTTCCGACATGGGGATCCTCCACCAGGGCTACTCCCTGAGCACTGGGTCTGATGCGGACTCGGACACCGAGGGAGGGATGTCTCCAGAACA
TGCCATCAGACTGTGGGGACGAGGGATAAAATCGAGGCGCAGCTCTGGCTTGTCCAGCCGCGAGAACTCAGCCCTTACTCTGACTGATTCTGACAATGAAAATAAATCGGATGACGACAATGGTCGAC
CCATTCCACCTACATCCTCGTCTAGCCTCCTCCCATCTGCTCAGCTGCCTAGCTCCCATAATCCTCCACCAGTTAGCTGCCAGATGCCATTGCTAGACAGCAACACCTCCCATCAGATCATGGACACC
AACCCCGATGAGGAATTCTCCCCTAATTCATACCTGCTCAGAGCATGCTCAGGGCCCCAGCAAGCCTCCAGTAGTGGCCCTCCGAACCACCACAGCCAGTCAACGCTGAGGCCCCCTCTGCCACCTCC
TCATAACCACACCCTGTCCCACCACCACTCCTCTGCCAACTCCCTCAACAGAAACTCACTGACCAATCGGCGGAGTCAAATCCACGCCCCAGCTCCTGCACCCAATGACCTGGCCACCACGCCGGAGT
CCGTTCAGCTCCAGGACAGCTGGGTGCTGAACAGTAACGTGCCGCTGGAGACGCGGCACTTCCTCTTCAAGACGTCCTCCGGAAGCACACCCCTGTTCAGCAGCTCTTCTCCAGGATACCCCTTGACC
TCAGGGACCGTTTATACACCACCACCCCGCCTGCTGCCACGGAATACATTCTCTAGGAAGGCCTTCAAGCTGAAGAAACCCTCCAAATACTGCAGTTGGAAATGCGCCGCCCTGTCTGCCATTGCCGC
TGCCCTCCTTCTGGCCATTTTGCTGGCCTATTTCATAGCAATGCATCTGCTCGGACTCAATTGGCAACTCCAGCCGGCAGATGGACACACCTTTAACAATGGCGTAAGGACCGGCTTACCAGGAAACG
ATGATGTGGCAACAGTGCCATCTGGAGGCAAAGTGCCCTGGTCGTTGAAAAACAGCAGCATAGACAGCGGCGAGGCAGAAGTCGGTCGACGGGTGACACAGGAAGTCCCACCAGGGGTGTTTTGGAGG
TCCCAGATTCACATCAGTCAGCCTCAGTTCTTAAAGTTCAACATCTCCCTGGGGAAGGATGCCCTCTTCGGCGTCTACATAAGAAGAGGACTGCCACCATCTCATGCACAGTATGACTTCATGGAACG
CCTGGACGGAAAGGAGAAGTGGAGTGTGGTCGAGTCACCCAGGGAACGCCGGAGCATCCAGACCCTGGTGCAGAACGAGGCTGTGTTCGTGCAGTACTTGGATGTGGGCCTGTGGCACCTCGCCTTCT
ACAATGACGGCAAGGACAAGGAGATGGTCTCCTTCAATACGGTTGTCTTAGATTCAGTGCAGGACTGTCCACGAAACTGCCACGGGAACGGCGAATGCGTGTCTGGACTGTGTCACTGTTTCCCAGGA
TTCCTAGGTGCAGACTGCGCTAAAGCTGCCTGCCCTGTTCTGTGCAGTGGGAATGGACAGTATTCCAAAGGGACATGCCAGTGCTACAGTGGCTGGAAAGGAGCAGAATGCGATGTGCCCATGAACCA
GTGCATCGATCCTTCCTGTGGGGGCCACGGCTCCTGCATTGATGGGAACTGCGTGTGTGCAGCTGGCTACAAGGGCGAGCACTGCGAAGAAGTGGATTGCTTGGATCCAACCTGCTCCAGCCATGGTG
TCTGTGTGAACGGAGAGTGTCTATGCAGCCCCGGCTGGGGCGGGCTCAACTGCGAGCTGGCGAGGGTCCAGTGCCCAGACCAGTGTAGTGGGCATGGCACTTACCTCCCTGACTCTGGCCTCTGCAAC
TGTGATCCGAATTGGATGGGTCCCGACTGCTCTGTTGAAGTGTGCTCAGTAGACTGTGGCACTCACGGCGTCTGCATCGGGGGAGCCTGCCGCTGTGAAGAGGGCTGGACAGGCGCGGCTTGTGACCA
GCGCGTGTGCCACCCCCGCTGCATTGAGCACGGGACCTGTAAAGATGGCAAATGTGAATGCCGAGAGGGCTGGAATGGTGAACACTGCACCATTGATGGCTGCCCTGATTTGTGCAACGGTAACGGGA
GATGCACACTGGGTCAGAACAGCTGGCAGTGTGTCTGCCAGACCGGCTGGAGAGGGCCCGGATGCAACGTTGCCATGGAAACCTCCTGCGCTGATAACAAGGATAATGAGGGAGATGGCCTGGTGGAC
TGCCTGGACCCTGACTGCTGCCTCCAGTCAGCCTGTCAGAACAGCCTGCTCTGTCGGGGGTCTCGGGACCCCTTGGACATCATTCAGCAAGGCCAGACAGACTGGCCTGCGGTGAAGTCCTTCTATGA
TCGTATCAAGCTCTTGGCAGGCAAGGACAGCACCCACATCATTCCTGGAGACAACCCCTTCAATAGCAGCCTGGTGTCTCTGATCCGAGGCCAAGTAGTAACCACGGATGGGACCCCCCTGGTGGGTG
TGAATGTGTCTTTTGTCAAGTACCCAAAATATGGCTACACCATCACTCGCCAGGACGGCACGTTTGACCTGATTGCCAATGGGGGCTCTGCCTTGACTCTTCACTTTGAGCGAGCCCCTTTCATGAGC
CGGGAGCGCACAGTATGGCCGCCGTGGAACAGCTTCTATGCCATGGACACCCTGGTAATGAAGACGGAGGAGAACTCCATCCCCAGCTGTGACCTCAGTGGCTTTGTCCGGCCTGATCCGATCATCAT
CTCCTCTCCTCTGTCCACCTTCTTCAGCGCTTCCCCTGCGGCGAACCCCATTGTGCCTGAGACCCAGGTTCTTCATGAGGAGATCGAGCTCCCTGGCACCAACGTGAAGCTCCGTTACCTCAGCTCCA
GAACAGCAGGGTACAAGTCACTGCTGAAGATCACCATGACCCAGTCCACGGTGCCCTTGAACCTCATCCGGGTTCACTTGATGGTTGCCGTGGAGGGGCATCTCTTCCAGAAGTCGTTCCAGGCTTCT
CCCAACCTGGCCTACACATTCATCTGGGACAAGACAGACGCTTATGGCCAAAGGGTTTATGGCCTATCGGATGCTGTTGTGTCTGTTGGATTTGAATATGAGACCTGCCCCAGTCTCATCCTGTGGGA
AAAAAGGACAGCCCTACTTCAAGGATTCGAGCTGGACCCTTCCAACCTTGGTGGCTGGTCCCTGGATAAGCACCACACCCTCAATGTGAAAAGCGGAATACTACTCAAAGGCACAGGGGAGAACCAGT
TCCTGACCCAGCAGCCCGCCATCATCACCAGCATCATGGGTAACGGTCGCCGCAGAAGCATCTCCTGTCCCAGCTGCAATGGCCTTGCTGAAGGCAACAAACTGTTGGCCCCCGTGGCCCTGGCTGTG
GGGATCGATGGGAGCCTCTTTGTCGGTGACTTCAATTATATCCGGCGCATCTTCCCTTCTCGAAACGTGACCAGTATCTTGGAGTTACGAAATAAAGAGTTTAAACATAGCAACAGCCCAGGACACAA
GTACTACTTGGCTGTGGACCCTGTGACTGGCTCGCTCTATGTCTCTGACACCAACAGTCGCCGGATCTACCGAGTCAAGTCTCTAAGCGGAGCCAAAGACCTGGCTGGGAATTCGGAAGTTGTGGCCG
GGACTGGCGAACAATGTCTACCCTTTGATGAAGCCCGCTGTGGGGATGGCGGGAAGGCTGTGGATGCCACCCTGATGAGCCCTAGAGGTATTGCAGTAGACAAGAACGGGCTTATGTATTTTGTTGAT
GCCACCATGATCCGGAAGGTCGACCAAAATGGAATCATCTCCACCCTGCTGGGCTCCAATGACCTCACAGCTGTCCGACCACTGAGCTGTGACTCTAGCATGGACGTGGCCCAGGTCCGTCTAGAATG
GCCGACAGACCTTGCGGTCAACCCCATGGACAATTCCCTGTACGTCCTGGAGAACAACGTCATCCTGCGGATCACCGAGAATCACCAGGTCAGCATCATCGCGGGACGGCCCATGCACTGCCAGGTTC
CCGGCATCGACTACTCGCTCAGCAAGCTCGCCATCCACTCTGCTCTGGAGTCAGCCAGCGCCATCGCCATTTCTCACACCGGGGTGCTCTACATCACCGAGACGGACGAGAAGAAGATCAACCGCCTA
CGCCAGGTCACCACCAACGGAGAGATCTGCCTCTTAGCCGGGGCAGCCTCAGACTGTGACTGCAAAAATGACGTCAACTGCATCTGCTATTCGGGAGATGACGCATACGCCACGGATGCCATCTTGAA
CTCCCCGTCCTCCTTAGCTGTGGCTCCGGATGGCACCATCTACATCGCAGACCTCGGGAATATCCGGATCAGGGCGGTCAGCAAAAACAAACCTGTTCTTAACGCGTTCAACCAGTATGAGGCTGCGT
CTCCGGGAGAACAGGAACTGTACGTGTTCAACGCCGATGGTATCCATCAGTACACCGTGAGCCTGGTGACCGGGGAGTACTTATACAATTTCACCTACAGCGCTGACAATGATGTCACCGAGTTGATT
GACAACAACGGGAATTCCCTAAAGATCCGCCGGGACAGCAGTGGCATGCCCCGACACCTGCTCATGCCTGATAATCAGATCATCACCCTTACGGTGGGCACCAACGGAGGCCTCAAAGCCGTGTCAAC
GCAGAACCTGGAGCTGGGCCTCATGACTTATGATGGGAACACTGGACTCCTAGCCACCAAGAGCGATGAAACCGGATGGACAACTTTTTATGACTATGACCACGAGGGCCGTCTGACCAATGTGACTC
GCCCCACGGGGGTGGTGACCAGCCTGCACCGGGAAATGGAGAAATCCATCACCGTTGACATTGAGAACTCCAACCGTGATAACGATGTCACTGTGATTACCAACCTCTCTTCAGTGGAGGCCTCCTAC
ACCGTGGTACAAGATCAAGTGCGGAACAGCTACCAGCTCTGCAGCAACGGGACCCTGCGCGTCATGTACGCCAACGGCATGGGCGTCAGCTTCCACAGCGAGCCCCACGTCCTCGCAGGCACCCTCAC
CCCCACCATCGGGCGCTGTAACATCTCCCTGCCCATGGAGAACGGCCTGAACTCCATCGAGTGGCGCCTGAGGAAGGAACAGATTAAAGGCAAAGTCACCATCTTTGGGAGGAAGCTTCGGGTCCACG
GAAGGAACCTCCTGTCCATTGATTATGACCGAAATATCCGCACTGAGAAGATCTATGACGACCACCGGAAGTTCACCCTGAGGATCATTTATGACCAGGTGGGCCGCCCCTTCCTGTGGCTCCCCAGC
AGTGGACTGGCGGCCGTCAATGTCTCCTACTTCTTCAACGGGCGCCTGGCCGGCCTCCAGCGCGGGGCCATGAGCGAGAGGACAGACATTGACAAGCAAGGCCGGATTGTGTCCCGAATGTTCGCCGA
CGGGAAAGTCTGGAGCTATTCCTACCTTGACAAGTCCATGGTCCTCCTGCTGCAGAGCCAGCGTCAGTACATATTTGAATATGACTCCTCTGACCGCCTCCACGCAGTCACCATGCCCAGTGTCGCCC
GGCACAGCATGTCCACGCACACCTCCATTGGCTACATCCGGAACATTTACAACCCACCGGAAAGCAACGCCTCGGTCATCTTTGACTACAGTGATGACGGCCGCATCCTGAAGACGTCTTTCCTGGGC
ACCGGGCGCCAGGTGTTCTATAAGTACGGAAAACTGTCCAAGTTATCGGAGATCGTCTACGACAGCACTGCCGTCACCTTCGGCTATGACGAGACCACTGGCGTCCTGAAGATGGTGAATCTCCAAAG
CGGGGGCTTCTCCTGTACCATCAGGTACCGAAAGGTCGGGCCCCTCGTGGACAAGCAGATTTACAGGTTCTCTGAGGAAGGCATGATCAACGCCAGGTTCGATTACACCTACCACGACAACAGCTTCC
GCATCGCCAGCATCAAGCCCGTCATCAGTGAGACTCCCCTTCCCGTTGACCTCTACCGCTACGATGAGATTTCTGGCAAGGTGGAACACTTCGGCAAGTTCGGGGTCATCTACTACGACATCAACCAG
ATCATCACCACTGCCGTCATGACACTCAGCAAGCACTTTGACACCCATGGGCGCATCAAGGAAGTGCAGTATGAGATGTTCCGGTCCCTCATGTACTGGATGACGGTGCAATATGACAGTATGGGCAG
GGTCATCAAGAGGGAACTGAAACTGGGGCCCTATGCCAACACCACAAAGTACACCTATGACTACGACGGGGACGGCCAGCTCCAGAGTGTGGCCGTCAATGACCGGCCTACCTGGCGTTATAGCTATG
ACCTCAATGGGAACCTGCACCTGCTAAACCCAGGAAACAGTGCTCGCCTCATGCCGTTACGCTATGACCTCCGTGACCGGATAACCAGGCTAGGGGACGTGCAGTACAAAATCGATGATGATGGCTAT
TTATGCCAGAGAGGATCTGACATCTTTGAATACAACTCCAAGGGCCTTCTAACGAGAGCGTACAACAAGGCCAGCGGGTGGAGTGTGCAGTACCGCTATGATGGCGTGAGCCGCCGGGCTTCCTACAA
GACCAACCTGGGCCACCACCTACAGTACTTCTATTCCGACCTCCACCACCCCACACGTATCACCCATGTTTACAACCACTCCAACTCTGAGATCACCTCACTCTACTATGACCTCCAGGGCCACCTCT
TTGCCATGGAGAGCAGTAGTGGGGAAGAGTACTATGTTGCCTCAGATAACACCGGGACTCCTCTGGCTGTTTTTAGTATCAATGGCCTCATGATCAAGCAACTCCAATACACAGCCTATGGGGAGATT
TACTATGACTCCAATCCAGACTTTCAGATGGTCATCGGCTTCCACGGAGGCCTCTACGACCCCCTCACCAAGCTCGTTCACTTTACGCAGCGTGATTATGACGTGCTGGCAGGACGGTGGACGTCCCC
CGACTACACCATGTGGAGGAATGTGGGCAAGGAGCCAGCCCCCTTCAACCTGTACATGTTCAAGAACAACAATCCACTCAGTAATGAGCTGGATTTAAAGAACTACGTGACAGACGTGAAGAGCTGGC
TCGTGATGTTTGGATTTCAGCTCAGCAACATCATTCCTGGATTCCCAAGAGCCAAAATGTATTTTGTGCCTCCCCCCTATGAACTGTCAGAGAGCCAAGCAAGTGAGAATGGACAGCTCATTACAGGT
GTCCAGCAGACAACAGAGAGGCATAACCAGGCCTTTCTGGCTCTAGAAGGACAGGTCATCTCTAAAAAGCTCCATGCAGGCATCCGAGAGAAAGCAGGCCACTGGTTTGCTACGACCACGCCCATCAT
CGGCAAAGGCATCATGTTCGCCATCAAAGAAGGGCGGGTGACCACAGGCGTGTCTAGCATCGCCAGTGAGGACAGCCGCAAGGTAGCATCCGTGTTGAACAACGCCTACTACTTGGACAAGATGCACT
ACAGCATCGAGGGCAAGGACACACACTACTTCGTGAAGATCGGTGCAGCGGACGGTGACCTGGTTACGCTGGGGACCACCATTGGGCGCAAGGTGCTGGAGAGCGGGGTGAACGTGACCGTGTCACAG
CCCACGCTGCTGGTGAACGGCAGGACTCGAAGGTTCACCAACATTGAATTCCAGTACTCCACGCTGCTGCTCAGCATACGCTACGGCCTCACCCCCGACACACTGGATGAAGAGAAGGCCCGCGTCCT
GGACCAAGCGCGACAGAGGGCCCTGGGTACTGCCTGGGCCAAGGAGCAGCAGAAAGCCAGGGACGGGAGAGAGGGCAGCCGTCTGTGGACGGAGGGCGAGAAGCAGCAACTCCTGAGCACGGGACGGG
TGCAAGGTTATGAGGGCTATTACGTGCTTCCGGTGGAACAGTACCCAGAGCTGGCAGACAGTAGCAGCAACATCCAGTTCTTAAGACAGAATGAGATGGGAAAGAGGTAACAAAATAACCTGCTGCCA
CCTCTTCTCTGGGTGGCTCAGCAGGAGCAACTGTGACCTCCTCTCCTAAGGAGACGAAGACCTAACAGGGGCACTGAGGCCGGGCTGCTTTAGGACCCCAAGTGGCAAGAAAGCTCACATTTTTTGAG
TTCAAATGCTACTGTCCAAGCGCAAAGTCCCTCATCCTGAAGTAGACTAGAGCTCGGCCACAAATTCTGAGGAAAACAAAACTAAAGGATGAACGAATGAACCAACGAACGAA

hide sequence

RefSeq Acc Id:

XM_039085063 ⟹ XP_038940991

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 22,121,001 (-)	NCBI
mRatBN7.2	10	20,482,113 - 21,706,415 (-)	NCBI

RefSeq Acc Id:

XM_039085066 ⟹ XP_038940994

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 22,121,001 (-)	NCBI
mRatBN7.2	10	20,482,113 - 21,705,812 (-)	NCBI

RefSeq Acc Id:

XM_039085068 ⟹ XP_038940996

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 22,121,001 (-)	NCBI
mRatBN7.2	10	20,482,113 - 21,705,812 (-)	NCBI

RefSeq Acc Id:

XM_039085069 ⟹ XP_038940997

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 22,121,001 (-)	NCBI
mRatBN7.2	10	20,482,113 - 21,705,812 (-)	NCBI

RefSeq Acc Id:

XM_039085070 ⟹ XP_038940998

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 22,121,001 (-)	NCBI
mRatBN7.2	10	20,482,113 - 21,705,812 (-)	NCBI

RefSeq Acc Id:

XM_039085071 ⟹ XP_038940999

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 22,121,001 (-)	NCBI
mRatBN7.2	10	20,482,113 - 21,705,811 (-)	NCBI

RefSeq Acc Id:

XM_039085072 ⟹ XP_038941000

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 21,667,732 (-)	NCBI
mRatBN7.2	10	20,482,113 - 21,163,766 (-)	NCBI

RefSeq Acc Id:

XM_039085074 ⟹ XP_038941002

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 21,419,039 (-)	NCBI
mRatBN7.2	10	20,482,113 - 20,905,100 (-)	NCBI

RefSeq Acc Id:

XM_039085075 ⟹ XP_038941003

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 21,419,039 (-)	NCBI
mRatBN7.2	10	20,482,113 - 20,905,100 (-)	NCBI

RefSeq Acc Id:

XM_039085076 ⟹ XP_038941004

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 21,667,733 (-)	NCBI
mRatBN7.2	10	20,482,113 - 21,163,766 (-)	NCBI

RefSeq Acc Id:

XM_063268319 ⟹ XP_063124389

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 22,001,337 (-)	NCBI

RefSeq Acc Id:

XM_063268320 ⟹ XP_063124390

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 22,121,001 (-)	NCBI

RefSeq Acc Id:

XM_063268321 ⟹ XP_063124391

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 21,667,733 (-)	NCBI

RefSeq Acc Id:

XM_063268322 ⟹ XP_063124392

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	20,984,710 - 21,667,732 (-)	NCBI


Protein RefSeqs	NP_064473	(Get FASTA)	NCBI Sequence Viewer
	XP_038940991	(Get FASTA)	NCBI Sequence Viewer
	XP_038940994	(Get FASTA)	NCBI Sequence Viewer
	XP_038940996	(Get FASTA)	NCBI Sequence Viewer
	XP_038940997	(Get FASTA)	NCBI Sequence Viewer
	XP_038940998	(Get FASTA)	NCBI Sequence Viewer
	XP_038940999	(Get FASTA)	NCBI Sequence Viewer
	XP_038941000	(Get FASTA)	NCBI Sequence Viewer
	XP_038941002	(Get FASTA)	NCBI Sequence Viewer
	XP_038941003	(Get FASTA)	NCBI Sequence Viewer
	XP_038941004	(Get FASTA)	NCBI Sequence Viewer
	XP_063124389	(Get FASTA)	NCBI Sequence Viewer
	XP_063124390	(Get FASTA)	NCBI Sequence Viewer
	XP_063124391	(Get FASTA)	NCBI Sequence Viewer
	XP_063124392	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD47383	(Get FASTA)	NCBI Sequence Viewer
	AAD47384	(Get FASTA)	NCBI Sequence Viewer
	AAD47385	(Get FASTA)	NCBI Sequence Viewer
	AAD47386	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011922
	ENSRNOP00000077386
	ENSRNOP00000099251
	ENSRNOP00000108300
	ENSRNOP00000109718
	ENSRNOP00000112023
GenBank Protein	Q9R1K2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_064473 ⟸ NM_020088

- UniProtKB:

A6HDJ4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDVKDRRHRSLTRGRCGKECRYTSSSLDSEDCRVPTQKSYSSSETLKAYDHDSRMHYGNRVTDLVHRESDEFSRQGANFTLAELGICEPSPHRSGYCSDMGILHQGYSLSTGSDADSDTEGGMSPEHA
IRLWGRGIKSRRSSGLSSRENSALTLTDSDNENKSDDDNGRPIPPTSSSSLLPSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASSSGPPNHHSQSTLRPPLPPPH
NHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTPESVQLQDSWVLNSNVPLETRHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLPRNTFSRKAFKLKKPSKYCSWKCAALSAIAAA
LLLAILLAYFIAMHLLGLNWQLQPADGHTFNNGVRTGLPGNDDVATVPSGGKVPWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFLKFNISLGKDALFGVYIRRGLPPSHAQYDFMERL
DGKEKWSVVESPRERRSIQTLVQNEAVFVQYLDVGLWHLAFYNDGKDKEMVSFNTVVLDSVQDCPRNCHGNGECVSGLCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQC
IDPSCGGHGSCIDGNCVCAAGYKGEHCEEVDCLDPTCSSHGVCVNGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDSGLCNCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQR
VCHPRCIEHGTCKDGKCECREGWNGEHCTIDGCPDLCNGNGRCTLGQNSWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQTDWPAVKSFYDR
IKLLAGKDSTHIIPGDNPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGSALTLHFERAPFMSRERTVWPPWNSFYAMDTLVMKTEENSIPSCDLSGFVRPDPIIIS
SPLSTFFSASPAANPIVPETQVLHEEIELPGTNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEK
RTALLQGFELDPSNLGGWSLDKHHTLNVKSGILLKGTGENQFLTQQPAIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNVTSILELRNKEFKHSNSPGHKY
YLAVDPVTGSLYVSDTNSRRIYRVKSLSGAKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGIISTLLGSNDLTAVRPLSCDSSMDVAQVRLEWP
TDLAVNPMDNSLYVLENNVILRITENHQVSIIAGRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCICYSGDDAYATDAILNS
PSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSADNDVTELIDNNGNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKAVSTQ
NLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITVDIENSNRDNDVTVITNLSSVEASYTVVQDQVRNSYQLCSNGTLRVMYANGMGVSFHSEPHVLAGTLTP
TIGRCNISLPMENGLNSIEWRLRKEQIKGKVTIFGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKFTLRIIYDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADG
KVWSYSYLDKSMVLLLQSQRQYIFEYDSSDRLHAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMVNLQSG
GFSCTIRYRKVGPLVDKQIYRFSEEGMINARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMFRSLMYWMTVQYDSMGRV
IKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTRAYNKASGWSVQYRYDGVSRRASYKT
NLGHHLQYFYSDLHHPTRITHVYNHSNSEITSLYYDLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPD
YTMWRNVGKEPAPFNLYMFKNNNPLSNELDLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQLITGVQQTTERHNQAFLALEGQVISKKLHAGIREKAGHWFATTTPIIG
KGIMFAIKEGRVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGAADGDLVTLGTTIGRKVLESGVNVTVSQPTLLVNGRTRRFTNIEFQYSTLLLSIRYGLTPDTLDEEKARVLD
QARQRALGTAWAKEQQKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQNEMGKR

hide sequence

Ensembl Acc Id:

ENSRNOP00000011922 ⟸ ENSRNOT00000011922

RefSeq Acc Id:	XP_038940991 ⟸ XM_039085063
- Peptide Label:	isoform X1
- UniProtKB:	Q9R1K2 (UniProtKB/Swiss-Prot), Q9R1K1 (UniProtKB/Swiss-Prot), Q9R1K0 (UniProtKB/Swiss-Prot), Q9R1J9 (UniProtKB/Swiss-Prot), A0A096P6L6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038940998 ⟸ XM_039085070
- Peptide Label:	isoform X5
- UniProtKB:	Q9R1K2 (UniProtKB/Swiss-Prot), Q9R1K1 (UniProtKB/Swiss-Prot), Q9R1K0 (UniProtKB/Swiss-Prot), Q9R1J9 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038940997 ⟸ XM_039085069
- Peptide Label:	isoform X4
- UniProtKB:	Q9R1K2 (UniProtKB/Swiss-Prot), Q9R1K1 (UniProtKB/Swiss-Prot), Q9R1K0 (UniProtKB/Swiss-Prot), Q9R1J9 (UniProtKB/Swiss-Prot)

Protein Domains

EGF-like Teneurin N-terminal

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-25535	BioCyc
Ensembl Genes	ENSRNOG00000027341	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000011922	ENTREZGENE
	ENSRNOT00000097791	ENTREZGENE
	ENSRNOT00000132901	ENTREZGENE
	ENSRNOT00000146782	ENTREZGENE
	ENSRNOT00000171102	ENTREZGENE
	ENSRNOT00000173444	ENTREZGENE
Gene3D-CATH	2.120.10.30	UniProtKB/Swiss-Prot
	Laminin	UniProtKB/Swiss-Prot
	RHS repeat-associated core	UniProtKB/Swiss-Prot
InterPro	6-blade_b-propeller_TolB-like	UniProtKB/Swiss-Prot
	CarboxyPept-like_regulatory	UniProtKB/Swiss-Prot
	EGF-like_Ca-bd_dom	UniProtKB/Swiss-Prot
	EGF-like_dom	UniProtKB/Swiss-Prot
	IPR006530	UniProtKB/Swiss-Prot
	Rhs_assc_core	UniProtKB/Swiss-Prot
	Ten_N	UniProtKB/Swiss-Prot
	Teneurin_domain	UniProtKB/Swiss-Prot
	Tox-GHH_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:117242	UniProtKB/Swiss-Prot
NCBI Gene	117242	ENTREZGENE
PANTHER	PTHR11219:SF8	UniProtKB/Swiss-Prot
	TENEURIN AND N-ACETYLGLUCOSAMINE-1-PHOSPHODIESTER ALPHA-N-ACETYLGLUCOSAMINIDASE	UniProtKB/Swiss-Prot
Pfam	Ten_N	UniProtKB/Swiss-Prot
	Tox-GHH	UniProtKB/Swiss-Prot
PhenoGen	Tenm2	PhenoGen
PROSITE	EGF_1	UniProtKB/Swiss-Prot
	EGF_2	UniProtKB/Swiss-Prot
	EGF_3	UniProtKB/Swiss-Prot
	TENEURIN_N	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000027341	RatGTEx
SMART	EGF	UniProtKB/Swiss-Prot
	EGF_CA	UniProtKB/Swiss-Prot
Superfamily-SCOP	DPP6 N-terminal domain-like	UniProtKB/Swiss-Prot
	NHL repeat	UniProtKB/Swiss-Prot
	SSF49464	UniProtKB/Swiss-Prot
UniProt	A0A096P6L6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y1H9	ENTREZGENE, UniProtKB/TrEMBL
	A6HDJ4	ENTREZGENE, UniProtKB/TrEMBL
	Q9R1J9	ENTREZGENE
	Q9R1K0	ENTREZGENE
	Q9R1K1	ENTREZGENE
	Q9R1K2	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q9R1J9	UniProtKB/Swiss-Prot
	Q9R1K0	UniProtKB/Swiss-Prot
	Q9R1K1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Tenm2	teneurin transmembrane protein 2	LOC102551468	teneurin-2-like	Data merged from RGD:7596091	737654	PROVISIONAL
2013-12-18	LOC102551468	teneurin-2-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2012-10-11	Tenm2	teneurin transmembrane protein 2	Odz2	odz, odd Oz/ten-m homolog 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-09	Odz2	odz, odd Oz/ten-m homolog 2 (Drosophila)	Odz2	odd Oz/ten-m homolog 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Odz2	odd Oz/ten-m homolog 2 (Drosophila)			Symbol and Name status set to approved	1299863	APPROVED

Note Type	Note	Reference
gene_expression	expressed in many types of neurons, including pyramidal cells in the cerebral cortex and tufted cells in the olfactory bulb during development	1299591

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD