Advanced Search (OLGA)

Gene: Scgb3a1 (secretoglobin, family 3A, member 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Scgb3a1

Name:

secretoglobin, family 3A, member 1

RGD ID:

727901

Description:

Predicted to be involved in positive regulation of myoblast fusion. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human SCGB3A1 (secretoglobin family 3A member 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bis(2-ethylhexyl) phthalate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Hin1; pneumo secretory protein 2; PnSP-2; Pnsp2; secretoglobin; secretoglobin family 3A member 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	34,469,166 - 34,470,473 (+)	NCBI		GRCr8
mRatBN7.2	10	33,968,059 - 33,969,366 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	33,968,059 - 33,969,476 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	38,643,651 - 38,644,958 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	7,182,054 - 7,183,361 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	33,637,313 - 33,638,620 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	35,133,561 - 35,134,868 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	35,133,252 - 35,135,466 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	34,905,080 - 34,906,387 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	35,125,569 - 35,126,876 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	35,127,288 - 35,128,035 (+)	NCBI
Celera	10	33,324,580 - 33,325,887 (+)	NCBI		Celera
Cytogenetic Map	10	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Scgb3a1	Rat	endometriosis		ISO	SCGB3A1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21063030

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Scgb3a1	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of SCGB3A1 mRNA and [Testosterone co-treated with Estradiol] results in increased expression of SCGB3A1 mRNA	CTD	PMID:26496021 and PMID:32741896
Scgb3a1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of SCGB3A1 mRNA	CTD	PMID:22298810
Scgb3a1	Rat	5-aza-2'-deoxycytidine	increases expression	ISO	SCGB3A1 (Homo sapiens)	6480464	Decitabine results in increased expression of SCGB3A1 mRNA	CTD	PMID:19442645
Scgb3a1	Rat	5-aza-2'-deoxycytidine	decreases methylation	ISO	SCGB3A1 (Homo sapiens)	6480464	Decitabine results in decreased methylation of SCGB3A1 promoter	CTD	PMID:19442645
Scgb3a1	Rat	aflatoxin B1	increases expression	ISO	SCGB3A1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of SCGB3A1 mRNA	CTD	PMID:21641981
Scgb3a1	Rat	arsane	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Arsenic results in increased expression of SCGB3A1 mRNA	CTD	PMID:23221970
Scgb3a1	Rat	arsane	decreases methylation	ISO	SCGB3A1 (Homo sapiens)	6480464	Arsenic results in decreased methylation of SCGB3A1 gene	CTD	PMID:27838757
Scgb3a1	Rat	arsenic atom	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Arsenic results in increased expression of SCGB3A1 mRNA	CTD	PMID:23221970
Scgb3a1	Rat	arsenic atom	decreases methylation	ISO	SCGB3A1 (Homo sapiens)	6480464	Arsenic results in decreased methylation of SCGB3A1 gene	CTD	PMID:27838757
Scgb3a1	Rat	benzo[a]pyrene	multiple interactions	ISO	Scgb3a1 (Mus musculus)	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of SCGB3A1 mRNA]	CTD	PMID:22228805
Scgb3a1	Rat	benzo[a]pyrene	decreases methylation	ISO	SCGB3A1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of SCGB3A1 promoter	CTD	PMID:27901495
Scgb3a1	Rat	benzo[a]pyrene	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of SCGB3A1 mRNA	CTD	PMID:22228805 and PMID:23735875
Scgb3a1	Rat	Benzo[k]fluoranthene	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	benzo(k)fluoranthene results in increased expression of SCGB3A1 mRNA	CTD	PMID:26377693
Scgb3a1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of SCGB3A1 mRNA	CTD	PMID:25031359
Scgb3a1	Rat	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of SCGB3A1 mRNA	CTD	PMID:25031359
Scgb3a1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of SCGB3A1 mRNA	CTD	PMID:26496021
Scgb3a1	Rat	bisphenol A	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	bisphenol A results in decreased expression of SCGB3A1 mRNA	CTD	PMID:32156529
Scgb3a1	Rat	bisphenol A	multiple interactions	ISO	SCGB3A1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of SCGB3A1 gene	CTD	PMID:31601247
Scgb3a1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of SCGB3A1 gene	CTD	PMID:28505145
Scgb3a1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SCGB3A1 mRNA	CTD	PMID:25181051
Scgb3a1	Rat	bisphenol F	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	bisphenol F results in decreased expression of SCGB3A1 mRNA	CTD	PMID:38685157
Scgb3a1	Rat	buta-1,3-diene	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	1 and 3-butadiene results in decreased expression of SCGB3A1 mRNA	CTD	PMID:29038090
Scgb3a1	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of SCGB3A1 promoter	CTD	PMID:22457795
Scgb3a1	Rat	calcium silicate	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	calcium silicate results in increased expression of SCGB3A1 mRNA	CTD	PMID:29279043
Scgb3a1	Rat	carbon nanotube	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of SCGB3A1 mRNA	CTD	PMID:25554681
Scgb3a1	Rat	carbon nanotube	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Nanotubes and Carbon results in decreased expression of SCGB3A1 mRNA	CTD	PMID:25554681
Scgb3a1	Rat	cefaloridine	increases expression	EXP		6480464	Cephaloridine results in increased expression of SCGB3A1 mRNA	CTD	PMID:18500788
Scgb3a1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of SCGB3A1 mRNA	CTD	PMID:27523638
Scgb3a1	Rat	dextran sulfate	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Dextran Sulfate results in increased expression of SCGB3A1 mRNA	CTD	PMID:35093514
Scgb3a1	Rat	dibenz[a,h]anthracene	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	1 more ...	CTD	PMID:26377693
Scgb3a1	Rat	doxorubicin	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Doxorubicin results in increased expression of SCGB3A1 mRNA	CTD	PMID:28608983
Scgb3a1	Rat	Erionite	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	erionite results in increased expression of SCGB3A1 mRNA	CTD	PMID:29279043
Scgb3a1	Rat	fulvestrant	multiple interactions	ISO	SCGB3A1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of SCGB3A1 gene	CTD	PMID:31601247
Scgb3a1	Rat	genistein	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of SCGB3A1 mRNA	CTD	PMID:25031359
Scgb3a1	Rat	genistein	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Genistein results in decreased expression of SCGB3A1 mRNA	CTD	PMID:32186404
Scgb3a1	Rat	isoprenaline	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Isoproterenol results in increased expression of SCGB3A1 mRNA	CTD	PMID:20003209
Scgb3a1	Rat	naphthalene	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	naphthalene results in decreased expression of SCGB3A1 mRNA	CTD	PMID:20522644
Scgb3a1	Rat	nitrofen	increases expression	EXP		6480464	nitrofen results in increased expression of SCGB3A1 mRNA	CTD	PMID:33484710
Scgb3a1	Rat	ozone	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	Ozone results in decreased expression of SCGB3A1 mRNA	CTD	PMID:33026818
Scgb3a1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of SCGB3A1 mRNA	CTD	PMID:30723492
Scgb3a1	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of SCGB3A1 mRNA	CTD	PMID:32680482
Scgb3a1	Rat	perfluorooctane-1-sulfonic acid	increases expression	EXP		6480464	perfluorooctane sulfonic acid results in increased expression of SCGB3A1 mRNA	CTD	PMID:22237054
Scgb3a1	Rat	sodium arsenite	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	sodium arsenite results in decreased expression of SCGB3A1 mRNA	CTD	PMID:18812580
Scgb3a1	Rat	testosterone	multiple interactions	EXP		6480464	[Testosterone co-treated with Estradiol] results in increased expression of SCGB3A1 mRNA	CTD	PMID:32741896
Scgb3a1	Rat	titanium dioxide	decreases expression	ISO	Scgb3a1 (Mus musculus)	6480464	titanium dioxide results in decreased expression of SCGB3A1 mRNA	CTD	PMID:23557971 and PMID:35295148
Scgb3a1	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of SCGB3A1 mRNA	CTD	PMID:30012374
Scgb3a1	Rat	tremolite asbestos	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	tremolite results in increased expression of SCGB3A1 mRNA	CTD	PMID:29279043
Scgb3a1	Rat	triptonide	increases expression	ISO	Scgb3a1 (Mus musculus)	6480464	triptonide results in increased expression of SCGB3A1 mRNA	CTD	PMID:33045310
Scgb3a1	Rat	valproic acid	increases methylation	ISO	SCGB3A1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of SCGB3A1 gene	CTD	PMID:29154799
Scgb3a1	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of SCGB3A1 mRNA	CTD	PMID:19015723

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Scgb3a1	Rat	positive regulation of myoblast fusion	involved_in	IBA	MGI:1915912 and PANTHER:PTN002165930	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Scgb3a1	Rat	positive regulation of myoblast fusion	acts_upstream_of_or_within	ISO	Scgb3a1 (Mus musculus)	1624291	PMID:23844157	RGD	PMID:23844157

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Scgb3a1	Rat	extracellular region		TAS		1299458		RGD
Scgb3a1	Rat	extracellular space	located_in	ISO	SCGB3A1 (Homo sapiens)	1624291	PMID:11481438	RGD	PMID:11481438
Scgb3a1	Rat	extracellular space	is_active_in	IBA	PANTHER:PTN002165929 and UniProtKB:Q96QR1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Scgb3a1	Rat	extracellular space	located_in	IEA	InterPro:IPR040301	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Scgb3a1	Rat	protein binding	enables	ISO	SCGB3A1 (Homo sapiens)	1624291	UniProtKB:Q6NTF9-3 and PMID:32296183	RGD	PMID:32296183

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	Secretoglobins SCGB3A1 and SCGB3A2 define secretory cell subsets in mouse and human airways.	Reynolds SD, etal., Am J Respir Crit Care Med 2002 Dec 1;166(11):1498-509. Epub 2002 Aug 1.
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11481438	PMID:16502470	PMID:19199708	PMID:23844157

Scgb3a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	34,469,166 - 34,470,473 (+)	NCBI		GRCr8
mRatBN7.2	10	33,968,059 - 33,969,366 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	33,968,059 - 33,969,476 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	38,643,651 - 38,644,958 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	7,182,054 - 7,183,361 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	33,637,313 - 33,638,620 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	35,133,561 - 35,134,868 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	35,133,252 - 35,135,466 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	34,905,080 - 34,906,387 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	35,125,569 - 35,126,876 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	35,127,288 - 35,128,035 (+)	NCBI
Celera	10	33,324,580 - 33,325,887 (+)	NCBI		Celera
Cytogenetic Map	10	q21	NCBI

SCGB3A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	180,590,105 - 180,591,499 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	180,590,105 - 180,591,499 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	180,017,105 - 180,018,499 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	179,949,711 - 179,951,093 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	179,949,711 - 179,951,093	NCBI
Celera	5	175,639,688 - 175,641,070 (-)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	174,741,080 - 174,742,462 (-)	NCBI		HuRef
CHM1_1	5	179,449,540 - 179,450,922 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	181,145,993 - 181,147,387 (-)	NCBI		T2T-CHM13v2.0

Scgb3a1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	49,554,422 - 49,555,945 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	49,554,437 - 49,555,945 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	49,663,595 - 49,665,118 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	49,663,610 - 49,665,118 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	49,477,112 - 49,478,620 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	49,507,033 - 49,508,541 (+)	NCBI		MGSCv36	mm8
Celera	11	54,225,407 - 54,226,915 (+)	NCBI		Celera
Cytogenetic Map	11	B1.2	NCBI
cM Map	11	29.75	NCBI

Scgb3a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	147,777 - 149,227 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	147,777 - 149,227 (+)	NCBI	ChiLan1.0	ChiLan1.0

SCGB3A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	175,612,543 - 175,614,602 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	173,776,623 - 173,778,685 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	175,792,429 - 175,797,122 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

Scgb3a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	119,092,049 - 119,093,637 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936739	301,760 - 303,416 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936739	300,579 - 303,414 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SCGB3A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	78,125,825 - 78,127,793 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	78,125,874 - 78,127,791 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	79,514,776 - 79,560,816 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SCGB3A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	82,315,106 - 82,317,600 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666075	13,735,739 - 13,737,333 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Scgb3a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	43,195,143 - 43,196,568 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	43,195,131 - 43,196,655 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Scgb3a1
4 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	36
Count of miRNA genes:	34
Interacting mature miRNAs:	35
Transcripts:	ENSRNOT00000051916
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	27957626	34490668	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
631531	Iresp2	Immunoglobin response QTL2	6.3		blood immunoglobulin E amount (VT:0002492)	serum immunoglobulin E level (CMO:0002101)	10	22918268	36400810	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

RH139977

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	34,470,025 - 34,470,575 (+)	Marker Load Pipeline
mRatBN7.2	10	33,968,918 - 33,969,468 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	35,134,421 - 35,134,970	NCBI	Rnor6.0
Rnor_5.0	10	34,905,940 - 34,906,489	UniSTS	Rnor5.0
RGSC_v3.4	10	35,126,429 - 35,126,978	UniSTS	RGSC3.4
Celera	10	33,325,440 - 33,325,989	UniSTS
RH 3.4 Map	10	366.4	UniSTS
Cytogenetic Map	10	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	29	46	55	54	23	25	23	6	130	75	26	15	37	31


RefSeq Transcripts	NM_001013180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF436841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BK000202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000051916 ⟹ ENSRNOP00000045446

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	33,968,059 - 33,969,366 (+)	Ensembl
Rnor_6.0 Ensembl	10	35,133,252 - 35,135,466 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113012 ⟹ ENSRNOP00000089765

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	33,968,482 - 33,969,476 (+)	Ensembl

RefSeq Acc Id:

NM_001013180 ⟹ NP_001013198

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	34,469,166 - 34,470,473 (+)	NCBI
mRatBN7.2	10	33,968,059 - 33,969,366 (+)	NCBI
Rnor_6.0	10	35,133,561 - 35,134,868 (+)	NCBI
Rnor_5.0	10	34,905,080 - 34,906,387 (+)	NCBI
RGSC_v3.4	10	35,125,569 - 35,126,876 (+)	RGD
Celera	10	33,324,580 - 33,325,887 (+)	RGD

Sequence:

show sequence

TCTCATTCCACCATGAAGCTCACCGCCATCTTTCTAGTGTTCTGTGTGGCTCTGCTCAGCGACTCTGGCGTTGCTTTCTTCGTGGATTCACTGGCCAAGCCTGTGGTAGAACCCGTGGCTGCCCTTGC
TCCAGCTGCAGAGGCTGTGGCAGGGGCTGTGCCTAGCCTACCATTAAGCCACTTGGCCATCCTGAGGTTCATCCTGGCCAGCCTGGGCATCCCATTGGATCCTCTCATAGATGGTTCCAGGAAGTGCG
TCACCGAGCTGGGCCCTGAGGCTGTAGGAGCTGTGAAGTCACTGCTGGGGGCCCTGACAACGTTCGGTTGAGGTG

hide sequence


Protein RefSeqs	NP_001013198	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ04483	(Get FASTA)	NCBI Sequence Viewer
	DAA00359	(Get FASTA)	NCBI Sequence Viewer
	EDM04227	(Get FASTA)	NCBI Sequence Viewer
	EDM04228	(Get FASTA)	NCBI Sequence Viewer
	EDM04229	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000045446
	ENSRNOP00000045446.2
	ENSRNOP00000089765.1

RefSeq Acc Id:	NP_001013198 ⟸ NM_001013180
- Peptide Label:	precursor
- UniProtKB:	Q71MT8 (UniProtKB/TrEMBL), E9PU36 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKLTAIFLVFCVALLSDSGVAFFVDSLAKPVVEPVAALAPAAEAVAGAVPSLPLSHLAILRFILASLGIPLDPLIDGSRKCVTELGPEAVGAVKSLLGALTTFG hide sequence

Ensembl Acc Id:

ENSRNOP00000045446 ⟸ ENSRNOT00000051916

Ensembl Acc Id:

ENSRNOP00000089765 ⟸ ENSRNOT00000113012

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PU36-F1-model_v2	AlphaFold	E9PU36	1-104	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13697144

Promoter ID:

EPDNEW_R7669

Type:

single initiation site

Name:

Scgb3a1_1

Description:

secretoglobin, family 3A, member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	35,133,527 - 35,133,587	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-25280	BioCyc
Ensembl Genes	ENSRNOG00000002718	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000051916	ENTREZGENE
	ENSRNOT00000051916.4	UniProtKB/TrEMBL
	ENSRNOT00000113012.1	UniProtKB/TrEMBL
InterPro	Secretoglobin_3A	UniProtKB/TrEMBL
KEGG Report	rno:338418	UniProtKB/TrEMBL
NCBI Gene	338418	ENTREZGENE
PANTHER	PTHR34829	UniProtKB/TrEMBL
	SECRETOGLOBIN FAMILY 3A MEMBER 1	UniProtKB/TrEMBL
Pfam	SCGB3A	UniProtKB/TrEMBL
PhenoGen	Scgb3a1	PhenoGen
RatGTEx	ENSRNOG00000002718	RatGTEx
UniProt	A0A8I6AB14_RAT	UniProtKB/TrEMBL
	A6HDX3_RAT	UniProtKB/TrEMBL
	A6HDX4_RAT	UniProtKB/TrEMBL
	E9PU36	ENTREZGENE, UniProtKB/TrEMBL
	Q71MT8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-11	Scgb3a1	secretoglobin, family 3A, member 1	Hin1	secretoglobin	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - CTD