Advanced Search (OLGA)

Gene: Lsamp (limbic system-associated membrane protein) Rattus norvegicus

Analyze

Symbol:

Lsamp

Name:

limbic system-associated membrane protein

RGD ID:

71102

Description:

Predicted to be involved in cell adhesion. Predicted to act upstream of or within locomotory exploration behavior. Is active in postsynaptic membrane and presynaptic membrane. Orthologous to human LSAMP (limbic system associated membrane protein); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC105298

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LSAMP (limbic system associated membrane protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Lsamp (limbic system-associated membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lsamp (limbic system associated membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LSAMP (limbic system associated membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LSAMP (limbic system associated membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lsamp (limbic system associated membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LSAMP (limbic system associated membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LSAMP (limbic system associated membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lsamp (limbic system associated membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Lsamp (limbic system associated membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Lsamp (limbic system-associated membrane protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	LSAMP (limbic system associated membrane protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lsamp (limbic system associated membrane protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rig-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31814	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG45781	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG45781	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	DIP-alpha	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	DIP-beta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	DIP-delta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	DIP-epsilon	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	DIP-theta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	DIP-zeta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	lsamp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	lsamp	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	72,053,285 - 74,223,019 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	72,053,285 - 72,702,134 (-)	Ensembl				GRCr8
mRatBN7.2	11	58,547,533 - 60,717,328 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	58,554,805 - 60,717,029 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	67,367,903 - 68,009,280 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	60,030,195 - 60,671,566 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	59,072,347 - 59,731,794 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	58,795,884 - 59,442,772 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	58,803,140 - 59,110,562 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	62,949,745 - 63,593,038 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	60,170,406 - 60,870,875 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	58,097,179 - 58,730,179 (-)	NCBI		Celera
RGSC_v3.1	11	60,227,994 - 60,928,464 (-)	NCBI
Cytogenetic Map	11	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

3,4-methylenedioxymethamphetamine (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium dichloride (EXP)

CGP 52608 (ISO)

chlordecone (ISO)

clotrimazole (EXP)

cocaine (EXP)

daunorubicin (ISO)

diarsenic trioxide (ISO)

dioxygen (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethanol (ISO)

fenvalerate (EXP)

formaldehyde (ISO)

fulvestrant (ISO)

lead(0) (ISO)

mercury dibromide (ISO)

methapyrilene (ISO)

methimazole (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

N,N-diethyl-m-toluamide (EXP)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (ISO)

ozone (ISO)

permethrin (EXP)

phenylmercury acetate (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

thapsigargin (ISO)

trichloroethene (EXP)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell adhesion (IEA)

heterophilic cell-cell adhesion (IBA)

locomotory exploration behavior (ISO)

regulation of synapse assembly (IBA)

Cellular Component

cytosol (ISO)

plasma membrane (IBA,IEA)

postsynaptic membrane (IDA)

presynaptic membrane (IDA)

side of membrane (IEA)

synapse (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Gene Data Set	MGD Curation, June 12, 2002
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	The limbic system-associated membrane protein is an Ig superfamily member that mediates selective neuronal growth and axon targeting.	Pimenta AF, etal., Neuron 1995 Aug;15(2):287-97.
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Isolation, biochemical characterization and ultrastructural analysis of the limbic system-associated membrane protein (LAMP), a protein expressed by neurons comprising functional neural circuits.	Zacco A, etal., J Neurosci. 1990 Jan;10(1):73-90. doi: 10.1523/JNEUROSCI.10-01-00073.1990.

Additional References at PubMed

PMID:12477932	PMID:14625014	PMID:15081109	PMID:18199495	PMID:28801670	PMID:29476059

Genomics

Comparative Map Data

Lsamp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	72,053,285 - 74,223,019 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	72,053,285 - 72,702,134 (-)	Ensembl				GRCr8
mRatBN7.2	11	58,547,533 - 60,717,328 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	58,554,805 - 60,717,029 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	67,367,903 - 68,009,280 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	60,030,195 - 60,671,566 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	59,072,347 - 59,731,794 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	58,795,884 - 59,442,772 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	58,803,140 - 59,110,562 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	62,949,745 - 63,593,038 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	60,170,406 - 60,870,875 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	58,097,179 - 58,730,179 (-)	NCBI		Celera
RGSC_v3.1	11	60,227,994 - 60,928,464 (-)	NCBI
Cytogenetic Map	11	q21	NCBI

LSAMP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	115,802,374 - 116,445,487 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	115,802,374 - 117,997,592 (-)	Ensembl			hg38	GRCh38
GRCh37	3	115,521,221 - 116,164,334 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	117,011,832 - 117,647,068 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	117,011,833 - 117,647,068	NCBI
Celera	3	113,929,271 - 114,572,430 (-)	NCBI		Celera
Cytogenetic Map	3	q13.31	NCBI
HuRef	3	112,897,118 - 113,540,663 (-)	NCBI		HuRef
CHM1_1	3	115,484,952 - 116,127,889 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	118,522,573 - 119,165,711 (-)	NCBI		T2T-CHM13v2.0

Lsamp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	39,804,674 - 42,002,042 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	41,353,220 - 42,002,042 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm39 Ensembl	16	39,804,723 - 41,229,914 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	39,984,254 - 42,181,679 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	39,984,361 - 42,181,679 (+)	Ensembl			mm10	GRCm38
MGSCv37	16	41,533,455 - 42,146,326 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	41,452,674 - 42,065,545 (+)	NCBI		MGSCv36	mm8
Celera	16	41,901,502 - 42,509,283 (+)	NCBI		Celera
Cytogenetic Map	16	B4	NCBI
cM Map	16	28.26	NCBI

Lsamp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	15,873,278 - 17,911,903 (-)	Ensembl
ChiLan1.0	NW_004955427	15,871,178 - 16,475,975 (-)	NCBI	ChiLan1.0	ChiLan1.0

LSAMP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	113,806,256 - 114,436,270 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	113,812,916 - 114,441,047 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	112,952,837 - 113,582,708 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	119,869,117 - 120,496,648 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	119,871,236 - 120,496,120 (-)	Ensembl			panPan2	panpan1.1

LSAMP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	19,833,604 - 20,478,800 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	19,841,111 - 20,478,776 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	19,939,960 - 20,579,121 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	20,079,910 - 20,727,054 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	20,082,975 - 20,727,018 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	19,886,366 - 20,530,790 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	19,934,283 - 20,567,250 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	20,478,555 - 21,125,027 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Lsamp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	133,775,828 - 134,368,441 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936536	3,161,345 - 3,745,641 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936536	3,161,009 - 3,746,148 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LSAMP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	143,675,575 - 144,304,151 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	143,675,521 - 144,304,186 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

LSAMP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	64,423,191 - 65,069,462 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	101,324,436 - 101,959,791 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lsamp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	31,872,494 - 32,542,316 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624731	31,872,211 - 32,550,089 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Lsamp
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	24,949,701 - 27,104,304 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Lsamp
18454 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	17
Interacting mature miRNAs:	22
Transcripts:	ENSRNOT00000042024, ENSRNOT00000047907
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	73308487	96070872	Rat
1598811	Bp291	Blood pressure QTL 291	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	33306008	78306008	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	58928336	99753367	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	36428416	81428416	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	73850894	99753367	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	34618760	79618760	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	58931822	92356038	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	57754837	96071021	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	67962184	99753367	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	73308315	99753367	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat
631510	Spl2	Serum phospholipid level QTL 2	4.1		blood phospholipid amount (VT:0006084)	serum phospholipid level (CMO:0001171)	11	27556685	72556685	Rat
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
1598841	Memor7	Memory QTL 7			exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	11	33306008	78306008	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	31915469	76915469	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	36749459	81749459	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	36749459	81749459	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	68599321	96497754	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	69855943	99753367	Rat

Markers in Region

D11Got51

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	58,828,731 - 58,828,933 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	59,077,526 - 59,077,727	NCBI	Rnor6.0
Rnor_5.0	11	63,228,592 - 63,228,793	UniSTS	Rnor5.0
RGSC_v3.4	11	60,464,437 - 60,464,639	RGD	RGSC3.4
RGSC_v3.4	11	60,464,438 - 60,464,639	UniSTS	RGSC3.4
Celera	11	58,364,412 - 58,364,613	UniSTS
RGSC_v3.1	11	60,522,026 - 60,522,228	RGD
RH 3.4 Map	11	528.8	UniSTS
RH 3.4 Map	11	528.8	RGD
RH 2.0 Map	11	222.1	RGD
Cytogenetic Map	11	q21	UniSTS

D11Got85

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	59,122,461 - 59,122,625 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	59,368,233 - 59,368,396	NCBI	Rnor6.0
Rnor_5.0	11	63,518,924 - 63,519,087	UniSTS	Rnor5.0
RGSC_v3.4	11	60,796,742 - 60,796,906	RGD	RGSC3.4
RGSC_v3.1	11	60,854,331 - 60,854,495	RGD
RH 3.4 Map	11	541.2	RGD
RH 3.4 Map	11	541.2	UniSTS
Cytogenetic Map	11	q21	UniSTS

BF399213

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	58,969,678 - 58,969,870 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	59,217,578 - 59,217,769	NCBI	Rnor6.0
Rnor_5.0	11	63,368,512 - 63,368,703	UniSTS	Rnor5.0
RGSC_v3.4	11	60,606,531 - 60,606,722	UniSTS	RGSC3.4
Celera	11	58,505,242 - 58,505,433	UniSTS
RH 3.4 Map	11	527.2	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH138298

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	58,855,766 - 58,855,909 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	59,103,856 - 59,103,998	NCBI	Rnor6.0
Rnor_5.0	11	63,254,850 - 63,254,992	UniSTS	Rnor5.0
RGSC_v3.4	11	60,492,249 - 60,492,391	UniSTS	RGSC3.4
Celera	11	58,391,352 - 58,391,494	UniSTS
RH 3.4 Map	11	525.1	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH128355

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	59,183,370 - 59,183,590 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	59,429,426 - 59,429,645	NCBI	Rnor6.0
Rnor_5.0	11	63,579,692 - 63,579,911	UniSTS	Rnor5.0
RGSC_v3.4	11	60,857,980 - 60,858,199	UniSTS	RGSC3.4
Celera	11	58,717,262 - 58,717,481	UniSTS
RH 3.4 Map	11	522.1	UniSTS
Cytogenetic Map	11	q21	UniSTS

BF386479

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	58,733,880 - 58,734,042 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	58,982,681 - 58,982,842	NCBI	Rnor6.0
Rnor_5.0	11	63,133,902 - 63,134,063	UniSTS	Rnor5.0
RGSC_v3.4	11	60,369,163 - 60,369,324	UniSTS	RGSC3.4
Celera	11	58,269,638 - 58,269,799	UniSTS
RH 3.4 Map	11	534.4	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH137877

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	58,559,084 - 58,559,219 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	58,807,388 - 58,807,522	NCBI	Rnor6.0
Rnor_5.0	11	62,960,559 - 62,960,693	UniSTS	Rnor5.0
RGSC_v3.4	11	60,174,631 - 60,174,765	UniSTS	RGSC3.4
Celera	11	58,101,411 - 58,101,545	UniSTS
RH 3.4 Map	11	536.6	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH138903

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	59,159,044 - 59,159,183 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	59,404,814 - 59,404,952	NCBI	Rnor6.0
Rnor_5.0	11	63,555,080 - 63,555,218	UniSTS	Rnor5.0
RGSC_v3.4	11	60,833,661 - 60,833,799	UniSTS	RGSC3.4
Celera	11	58,692,968 - 58,693,106	UniSTS
Cytogenetic Map	11	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	12	67	164	91	90	59	35	59	6	280	135	11	143	69	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001414997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_017242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY326256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213251	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U31554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000042024 ⟹ ENSRNOP00000047121

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	58,554,863 - 60,717,029 (-)	Ensembl
Rnor_6.0 Ensembl	11	58,803,198 - 59,110,562 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000047907 ⟹ ENSRNOP00000040165

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	72,059,776 - 72,702,134 (-)	Ensembl
mRatBN7.2 Ensembl	11	58,554,805 - 59,196,717 (-)	Ensembl
Rnor_6.0 Ensembl	11	58,803,140 - 59,110,562 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094287 ⟹ ENSRNOP00000089385

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	59,034,970 - 59,196,717 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098604 ⟹ ENSRNOP00000082574

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	58,584,179 - 59,196,717 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100246 ⟹ ENSRNOP00000085583

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	72,090,863 - 72,702,134 (-)	Ensembl
mRatBN7.2 Ensembl	11	58,554,863 - 59,196,717 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101139 ⟹ ENSRNOP00000085637

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	72,077,258 - 72,702,134 (-)	Ensembl
mRatBN7.2 Ensembl	11	58,554,998 - 59,196,717 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108300 ⟹ ENSRNOP00000096530

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	58,554,805 - 59,196,717 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000154067 ⟹ ENSRNOP00000100586

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	72,053,285 - 72,702,134 (-)	Ensembl

RefSeq Acc Id:

NM_001414997 ⟹ NP_001401926

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	72,053,285 - 74,222,967 (-)	NCBI
mRatBN7.2	11	58,547,533 - 60,717,324 (-)	NCBI

RefSeq Acc Id:

NM_017242 ⟹ NP_058938

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	72,053,285 - 72,702,455 (-)	NCBI
mRatBN7.2	11	58,547,533 - 59,196,733 (-)	NCBI
Rnor_6.0	11	58,803,219 - 59,442,321 (-)	NCBI
Rnor_5.0	11	62,949,745 - 63,593,038 (-)	NCBI
RGSC_v3.4	11	60,170,406 - 60,870,875 (-)	RGD
Celera	11	58,097,179 - 58,730,179 (-)	RGD

Sequence:

show sequence

GTGGCCAGCAGCGCGCACACGCGAGTCCACCGCTGACCAACTCGCCGAGGCCACCATGGTCGGG
AGAGTTCAACCTGATCGGAAACAGTTGCCACTGGTCCTACTGAGACTGCTCTGCCTTCTTCCCA
CAGGACTGCCCGTTCGCAGCGTGGATTTTAACCGAGGCACGGACAACATCACCGTGAGGCAGGG
GGACACGGCCATCCTCAGGTGTGTGGTAGAAGACAAGAACTCGAAAGTGGCCTGGTTGAACCGC
TCTGGCATCATCTTCGCTGGACACGACAAGTGGTCTCTGGACCCTCGGGTTGAGCTGGAGAAAC
GCCATGCTCTGGAATACAGCCTCCGAATCCAGAAGGTGGATGTCTATGATGAAGGATCCTACAC
ATGCTCAGTTCAGACACAGCATGAGCCCAAGACCTCTCAAGTTTACTTGATTGTACAAGTTCCA
CCAAAGATCTCCAACATCTCCTCGGATGTCACTGTGAATGAGGGCAGCAATGTAACCCTGGTCT
GCATGGCCAATGGGCGCCCTGAACCTGTTATCACCTGGAGACACCTTACACCACTTGGAAGAGA
ATTTGAAGGAGAAGAAGAATATCTGGAGATCCTAGGCATCACCAGGGAACAGTCAGGCAAATAT
GAGTGCAAGGCTGCCAACGAGGTCTCCTCCGCGGATGTCAAACAAGTCAAGGTCACTGTGAACT
ATCCACCCACCATCACAGAGTCTAAGAGCAATGAAGCCACCACAGGACGACAAGCTTCCCTCAA
ATGTGAAGCCTCAGCGGTGCCTGCACCTGACTTTGAGTGGTACCGGGATGACACCAGGATAAAC
AGTGCAAACGGCCTTGAGATTAAGAGCACTGAGGGCCAGTCCTCCCTGACGGTGACCAACGTCA
CTGAGGAACACTACGGCAACTATACCTGTGTGGCTGCCAACAAGCTCGGCGTCACCAATGCCAG
CCTAGTCCTTTTCAGACCCGGGTCGGTGAGAGGAATCAACGGATCCATCAGTCTGGCCGTACCA
CTGTGGCTGCTGGCAGCGTCCCTGTTCTGCCTTCTCAGCAAATGTTAATAGAATAAAAATTTAA
AAATAATTACAAAACACACAAAAATGCGTCACACAGATACAGAGAGAGAGAGAGAGAGAGAGAG
AAAGTACAAGATGGGGGGAGACTATTGTTTCACAAGATTGTGTGTTTATAAATGAAGGGGGGAT
AT

hide sequence

RefSeq Acc Id:

XM_039088255 ⟹ XP_038944183

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	72,053,288 - 74,223,019 (-)	NCBI
mRatBN7.2	11	58,547,533 - 60,717,328 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001401926	(Get FASTA)	NCBI Sequence Viewer
	NP_058938	(Get FASTA)	NCBI Sequence Viewer
	XP_038944183	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA86120	(Get FASTA)	NCBI Sequence Viewer
	AAH87607	(Get FASTA)	NCBI Sequence Viewer
	AAQ91613	(Get FASTA)	NCBI Sequence Viewer
	EDM11195	(Get FASTA)	NCBI Sequence Viewer
	EDM11196	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000040165.4
	ENSRNOP00000085583.1
	ENSRNOP00000100586
GenBank Protein	Q62813	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_058938 ⟸ NM_017242
- Peptide Label:	isoform 2 precursor
- UniProtKB:	Q6VUH9 (UniProtKB/Swiss-Prot), Q62813 (UniProtKB/Swiss-Prot), A6IR42 (UniProtKB/TrEMBL), A0A8I5ZZN4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVGRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAW LNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIV QVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPLGREFEGEEEYLEILGITREQS GKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDT RINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISL AVPLWLLAASLFCLLSKC hide sequence

Ensembl Acc Id:

ENSRNOP00000040165 ⟸ ENSRNOT00000047907

Ensembl Acc Id:

ENSRNOP00000047121 ⟸ ENSRNOT00000042024

RefSeq Acc Id:	XP_038944183 ⟸ XM_039088255
- Peptide Label:	isoform X1
- UniProtKB:	A0A0H2UHY3 (UniProtKB/TrEMBL), A0A8I5ZZN4 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000096530 ⟸ ENSRNOT00000108300

Ensembl Acc Id:

ENSRNOP00000085637 ⟸ ENSRNOT00000101139

Ensembl Acc Id:

ENSRNOP00000082574 ⟸ ENSRNOT00000098604

Ensembl Acc Id:

ENSRNOP00000089385 ⟸ ENSRNOT00000094287

Ensembl Acc Id:

ENSRNOP00000085583 ⟸ ENSRNOT00000100246

RefSeq Acc Id:	NP_001401926 ⟸ NM_001414997
- Peptide Label:	isoform 1 precursor
- UniProtKB:	A0A0H2UHW7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000100586 ⟸ ENSRNOT00000154067

Protein Domains

Ig-like Ig-like C2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62813-F1-model_v2	AlphaFold	Q62813	1-338	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71102	AgrOrtholog
BioCyc Gene	G2FUF-21309	BioCyc
Ensembl Genes	ENSRNOG00000031852	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000047907.5	UniProtKB/Swiss-Prot
	ENSRNOT00000100246.1	UniProtKB/Swiss-Prot
	ENSRNOT00000154067	ENTREZGENE
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7314244	IMAGE-MGC_LOAD
InterPro	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_I-set	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
	Ig_sub2	UniProtKB/Swiss-Prot
	IgLON_domain	UniProtKB/Swiss-Prot
KEGG Report	rno:29561	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105298	IMAGE-MGC_LOAD
NCBI Gene	29561	ENTREZGENE
PANTHER	IGLON FAMILY OF IMMUNOGLOBULIN SUPERFAMILY-RELATED	UniProtKB/Swiss-Prot
	LIMBIC SYSTEM-ASSOCIATED MEMBRANE PROTEIN	UniProtKB/Swiss-Prot
Pfam	I-set	UniProtKB/Swiss-Prot
	Ig_3	UniProtKB/Swiss-Prot
PhenoGen	Lsamp	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000031852	RatGTEx
SMART	IGc2	UniProtKB/Swiss-Prot
	SM00409	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHW7	ENTREZGENE, UniProtKB/TrEMBL
	A0A0H2UHY3	ENTREZGENE
	A0A8I5ZZN4	ENTREZGENE, UniProtKB/TrEMBL
	A6IR42	ENTREZGENE, UniProtKB/TrEMBL
	LSAMP_RAT	UniProtKB/Swiss-Prot
	Q5M960_RAT	UniProtKB/TrEMBL
	Q62813	ENTREZGENE
	Q6VUH9	ENTREZGENE
UniProt Secondary	Q6VUH9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-07-09	Lsamp	limbic system-associated membrane protein			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in limbic-associated cortical and subcortical neurons	70635

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message