Symbol:
Itga7
Name:
integrin subunit alpha 7
RGD ID:
71022
Description:
Enables integrin binding activity and laminin binding activity. Involved in cell adhesion; integrin-mediated signaling pathway; and skeletal muscle tissue development. Located in cell surface. Part of integrin complex. Used to study cardiomyopathy. Biomarker of arteriosclerosis. Human ortholog(s) of this gene implicated in Duchenne muscular dystrophy; congenital muscular dystrophy due to integrin alpha-7 deficiency; and muscular disease. Orthologous to human ITGA7 (integrin subunit alpha 7); PARTICIPATES IN integrin mediated signaling pathway; arrhythmogenic right ventricular cardiomyopathy pathway; cell-extracellular matrix signaling pathway; INTERACTS WITH 2,2',4,4',5,5'-hexachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha 7A integrin; H36-alpha7; integrin alpha 7; integrin alpha-7; integrin, alpha 7; MGC105724
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 1,944,447 - 1,973,347 (+) NCBI GRCr8 mRatBN7.2 7 1,360,125 - 1,388,886 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 1,359,940 - 1,388,450 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 4,124,517 - 4,151,033 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 6,000,177 - 6,026,675 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 6,301,622 - 6,327,909 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 3,355,079 - 3,383,886 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 3,355,116 - 3,384,675 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 3,325,268 - 3,354,361 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 2,230,747 - 2,269,403 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 2,230,888 - 2,269,401 (+) NCBI Celera 7 1,231,167 - 1,259,461 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Itga7 Rat (1->4)-beta-D-glucan multiple interactions ISO Itga7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ITGA7 mRNA CTD PMID:36331819 Itga7 Rat 1,2-dimethylhydrazine increases expression ISO Itga7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ITGA7 mRNA CTD PMID:22206623 Itga7 Rat 17beta-estradiol increases expression ISO Itga7 (Mus musculus) 6480464 Estradiol results in increased expression of ITGA7 mRNA CTD PMID:39298647 Itga7 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Itga7 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO ITGA7 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Itga7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of ITGA7 mRNA] CTD PMID:21215274 Itga7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ITGA7 mRNA CTD PMID:34747641 Itga7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Itga7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ITGA7 mRNA CTD PMID:21570461 and PMID:24680724 Itga7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ITGA7 mRNA CTD PMID:21215274 Itga7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ITGA7 mRNA CTD PMID:22298810 Itga7 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Itga7 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Itga7 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Itga7 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ITGA7 mRNA CTD PMID:21346803 Itga7 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Itga7 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Itga7 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ITGA7 mRNA CTD PMID:26251327 Itga7 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ITGA7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of ITGA7 mRNA CTD PMID:28628672 Itga7 Rat 3-methylcholanthrene multiple interactions ISO Itga7 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of ITGA7 mRNA CTD PMID:23519560 Itga7 Rat 4,4'-sulfonyldiphenol increases expression ISO ITGA7 (Homo sapiens) 6480464 bisphenol S results in increased expression of ITGA7 mRNA CTD PMID:27685785 Itga7 Rat 4,4'-sulfonyldiphenol increases expression ISO Itga7 (Mus musculus) 6480464 bisphenol S results in increased expression of ITGA7 mRNA CTD PMID:39298647 Itga7 Rat 4-hydroxynon-2-enal decreases expression ISO ITGA7 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of ITGA7 mRNA CTD PMID:12419474 Itga7 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ITGA7 mRNA CTD PMID:24780913 Itga7 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ITGA7 mRNA CTD PMID:31881176 Itga7 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of ITGA7 mRNA CTD PMID:28959563 Itga7 Rat aflatoxin B1 decreases methylation ISO ITGA7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ITGA7 intron CTD PMID:30157460 Itga7 Rat Allylamine increases expression EXP 6480464 Allylamine results in increased expression of ITGA7 mRNA and Allylamine results in increased expression of ITGA7 protein CTD PMID:14988073 Itga7 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ITGA7 mRNA CTD PMID:35163327 Itga7 Rat arsane affects expression ISO ITGA7 (Homo sapiens) 6480464 Arsenic affects the expression of ITGA7 mRNA CTD PMID:18414638 Itga7 Rat arsenic atom affects expression ISO ITGA7 (Homo sapiens) 6480464 Arsenic affects the expression of ITGA7 mRNA CTD PMID:18414638 Itga7 Rat arsenite(3-) decreases expression ISO Itga7 (Mus musculus) 6480464 arsenite results in decreased expression of ITGA7 mRNA CTD PMID:18929588 Itga7 Rat arsenite(3-) multiple interactions ISO Itga7 (Mus musculus) 6480464 TRP53 protein affects the reaction [arsenite results in decreased expression of ITGA7 mRNA] CTD PMID:18929588 Itga7 Rat atrazine multiple interactions ISO ITGA7 (Homo sapiens) 6480464 [Atrazine co-treated with Arsenates] results in increased expression of ITGA7 mRNA CTD PMID:18585445 Itga7 Rat benzo[a]pyrene increases expression ISO Itga7 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ITGA7 mRNA CTD PMID:22228805 Itga7 Rat benzo[a]pyrene affects methylation ISO ITGA7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ITGA7 promoter CTD PMID:27901495 Itga7 Rat benzo[a]pyrene decreases methylation ISO ITGA7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ITGA7 3' UTR CTD PMID:27901495 Itga7 Rat benzo[a]pyrene multiple interactions ISO Itga7 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of ITGA7 mRNA CTD PMID:27858113 Itga7 Rat benzo[b]fluoranthene multiple interactions ISO Itga7 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of ITGA7 mRNA CTD PMID:27858113 Itga7 Rat beta-lapachone decreases expression ISO ITGA7 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ITGA7 mRNA CTD PMID:38218311 Itga7 Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of ITGA7 mRNA CTD PMID:16648578 Itga7 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of ITGA7 promoter CTD PMID:23359474 Itga7 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Itga7 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ITGA7 mRNA CTD PMID:39150890 Itga7 Rat bis(2-ethylhexyl) phthalate decreases expression ISO ITGA7 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of ITGA7 mRNA CTD PMID:31163220 Itga7 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of ITGA7 promoter CTD PMID:23359474 Itga7 Rat bisphenol A decreases expression ISO Itga7 (Mus musculus) 6480464 bisphenol A results in decreased expression of ITGA7 mRNA CTD PMID:37105096 Itga7 Rat bisphenol A increases expression ISO Itga7 (Mus musculus) 6480464 bisphenol A results in increased expression of ITGA7 mRNA CTD PMID:32156529 Itga7 Rat bisphenol A decreases expression ISO ITGA7 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ITGA7 protein CTD PMID:34186270 Itga7 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ITGA7 gene CTD PMID:28505145 Itga7 Rat bisphenol A increases methylation ISO Itga7 (Mus musculus) 6480464 bisphenol A results in increased methylation of ITGA7 promoter CTD PMID:27312807 Itga7 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ITGA7 mRNA CTD PMID:25181051 Itga7 Rat bisphenol AF increases expression ISO ITGA7 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ITGA7 protein CTD PMID:34186270 Itga7 Rat bisphenol F decreases expression ISO Itga7 (Mus musculus) 6480464 bisphenol F results in decreased expression of ITGA7 mRNA CTD PMID:38685157 Itga7 Rat butanal increases expression ISO ITGA7 (Homo sapiens) 6480464 butyraldehyde results in increased expression of ITGA7 mRNA CTD PMID:26079696 Itga7 Rat Butylbenzyl phthalate multiple interactions ISO Itga7 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ITGA7 mRNA CTD PMID:39150890 Itga7 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of ITGA7 mRNA CTD PMID:19167457 Itga7 Rat cadmium atom multiple interactions ISO ITGA7 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ITGA7 mRNA CTD PMID:35301059 Itga7 Rat cadmium dichloride affects methylation EXP 6480464 Cadmium Chloride affects the methylation of ITGA7 promoter CTD PMID:22457795 Itga7 Rat cadmium dichloride multiple interactions ISO ITGA7 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ITGA7 mRNA CTD PMID:35301059 Itga7 Rat calcitriol increases expression ISO ITGA7 (Homo sapiens) 6480464 Calcitriol results in increased expression of ITGA7 mRNA CTD PMID:16002434 Itga7 Rat carbon nanotube increases expression ISO Itga7 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Itga7 Rat chrysene multiple interactions ISO Itga7 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of ITGA7 mRNA CTD PMID:27858113 Itga7 Rat copper atom multiple interactions ISO ITGA7 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ITGA7 mRNA CTD PMID:30911355 Itga7 Rat copper(0) multiple interactions ISO ITGA7 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ITGA7 mRNA CTD PMID:30911355 Itga7 Rat cyclosporin A decreases expression ISO ITGA7 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ITGA7 mRNA CTD PMID:20106945 and PMID:27989131 Itga7 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of ITGA7 mRNA CTD PMID:23640034 Itga7 Rat dexamethasone increases expression ISO ITGA7 (Homo sapiens) 6480464 Dexamethasone results in increased expression of ITGA7 mRNA CTD PMID:25047013 Itga7 Rat dexamethasone multiple interactions ISO ITGA7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of ITGA7 mRNA CTD PMID:28628672 Itga7 Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of ITGA7 promoter CTD PMID:23359474 Itga7 Rat dibutyl phthalate multiple interactions ISO Itga7 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ITGA7 mRNA CTD PMID:39150890 Itga7 Rat diethyl phthalate multiple interactions ISO Itga7 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ITGA7 mRNA CTD PMID:39150890 Itga7 Rat diisobutyl phthalate multiple interactions ISO Itga7 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ITGA7 mRNA CTD PMID:39150890 Itga7 Rat diisononyl phthalate multiple interactions ISO Itga7 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ITGA7 mRNA CTD PMID:39150890 Itga7 Rat diquat increases expression ISO Itga7 (Mus musculus) 6480464 Diquat results in increased expression of ITGA7 mRNA CTD PMID:36851058 Itga7 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ITGA7 mRNA CTD PMID:21551480 Itga7 Rat doxorubicin decreases expression ISO ITGA7 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ITGA7 mRNA CTD PMID:29803840 Itga7 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ITGA7 mRNA CTD PMID:29391264 Itga7 Rat ethanol increases expression ISO Itga7 (Mus musculus) 6480464 Ethanol results in increased expression of ITGA7 mRNA CTD PMID:30319688 Itga7 Rat fenamidone increases expression ISO Itga7 (Mus musculus) 6480464 fenamidone results in increased expression of ITGA7 mRNA CTD PMID:27029645 Itga7 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of ITGA7 mRNA CTD PMID:23962444 Itga7 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of ITGA7 mRNA CTD PMID:18035473 Itga7 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of ITGA7 mRNA CTD PMID:24136188 Itga7 Rat FR900359 decreases phosphorylation ISO ITGA7 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of ITGA7 protein CTD PMID:37730182 Itga7 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ITGA7 mRNA CTD PMID:33387578 Itga7 Rat hydrogen peroxide decreases expression ISO ITGA7 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of ITGA7 mRNA CTD PMID:12419474 Itga7 Rat indometacin multiple interactions ISO ITGA7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of ITGA7 mRNA CTD PMID:28628672 Itga7 Rat lipopolysaccharide decreases expression ISO Itga7 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of ITGA7 mRNA CTD PMID:12057914 Itga7 Rat lipopolysaccharide increases expression ISO ITGA7 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of ITGA7 mRNA CTD PMID:35953652 Itga7 Rat lipopolysaccharide multiple interactions ISO ITGA7 (Homo sapiens) 6480464 Lipopolysaccharides promotes the reaction [Sevoflurane results in increased expression of ITGA7 mRNA] CTD PMID:35953652 Itga7 Rat lipopolysaccharide increases expression ISO Itga7 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of ITGA7 mRNA CTD PMID:12057914 Itga7 Rat maneb multiple interactions ISO Itga7 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ITGA7 mRNA CTD PMID:36117858 Itga7 Rat monosodium L-glutamate multiple interactions ISO Itga7 (Mus musculus) 6480464 [Sodium Glutamate co-treated with Trans Fatty Acids] results in increased expression of ITGA7 mRNA CTD PMID:19001666 Itga7 Rat nickel atom decreases expression ISO ITGA7 (Homo sapiens) 6480464 Nickel results in decreased expression of ITGA7 mRNA CTD PMID:24768652 and PMID:25583101 Itga7 Rat nickel sulfate decreases expression ISO ITGA7 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of ITGA7 mRNA CTD PMID:22714537 Itga7 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of ITGA7 mRNA CTD PMID:18417182 Itga7 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of ITGA7 mRNA CTD PMID:26667333 Itga7 Rat ozone multiple interactions ISO Itga7 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of ITGA7 mRNA CTD PMID:34911549 Itga7 Rat paracetamol affects expression ISO Itga7 (Mus musculus) 6480464 Acetaminophen affects the expression of ITGA7 mRNA CTD PMID:17562736 Itga7 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ITGA7 mRNA CTD PMID:33387578 Itga7 Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of ITGA7 mRNA CTD PMID:16854511 Itga7 Rat paraquat multiple interactions ISO Itga7 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ITGA7 mRNA CTD PMID:36117858 Itga7 Rat pentanal increases expression ISO ITGA7 (Homo sapiens) 6480464 pentanal results in increased expression of ITGA7 mRNA CTD PMID:26079696 Itga7 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Itga7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ITGA7 mRNA CTD PMID:36331819 Itga7 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ITGA7 mRNA CTD PMID:35163327 Itga7 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of ITGA7 mRNA CTD PMID:15059925 Itga7 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Itga7 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of ITGA7 mRNA CTD PMID:23519560 Itga7 Rat pirinixic acid decreases expression ISO Itga7 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ITGA7 mRNA CTD PMID:20059764 Itga7 Rat pirinixic acid multiple interactions ISO Itga7 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of ITGA7 mRNA] CTD PMID:20059764 Itga7 Rat progesterone increases expression ISO ITGA7 (Homo sapiens) 6480464 Progesterone results in increased expression of ITGA7 mRNA CTD PMID:18037150 Itga7 Rat propanal increases expression ISO ITGA7 (Homo sapiens) 6480464 propionaldehyde results in increased expression of ITGA7 mRNA CTD PMID:26079696 Itga7 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of ITGA7 mRNA CTD PMID:28374803 Itga7 Rat sevoflurane decreases expression ISO ITGA7 (Homo sapiens) 6480464 Sevoflurane results in decreased expression of ITGA7 mRNA CTD PMID:35953652 Itga7 Rat sevoflurane multiple interactions ISO ITGA7 (Homo sapiens) 6480464 Lipopolysaccharides promotes the reaction [Sevoflurane results in increased expression of ITGA7 mRNA] CTD PMID:35953652 Itga7 Rat sodium arsenite increases expression ISO ITGA7 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ITGA7 mRNA CTD PMID:38568856 Itga7 Rat sunitinib decreases expression ISO ITGA7 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ITGA7 mRNA CTD PMID:31533062 Itga7 Rat tert-butyl hydroperoxide decreases expression ISO ITGA7 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ITGA7 mRNA CTD PMID:15336504 Itga7 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of ITGA7 mRNA CTD PMID:15963342 Itga7 Rat tetraphene multiple interactions ISO Itga7 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of ITGA7 mRNA CTD PMID:27858113 Itga7 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ITGA7 mRNA CTD PMID:34492290 Itga7 Rat titanium dioxide increases expression ISO Itga7 (Mus musculus) 6480464 titanium dioxide results in increased expression of ITGA7 mRNA CTD PMID:27760801 Itga7 Rat titanium dioxide decreases methylation ISO Itga7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ITGA7 gene and titanium dioxide results in decreased methylation of ITGA7 promoter CTD PMID:35295148 Itga7 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ITGA7 mRNA CTD PMID:33387578 Itga7 Rat trichostatin A decreases expression ISO ITGA7 (Homo sapiens) 6480464 trichostatin A results in decreased expression of ITGA7 mRNA CTD PMID:24935251 Itga7 Rat triclosan decreases expression ISO ITGA7 (Homo sapiens) 6480464 Triclosan results in decreased expression of ITGA7 mRNA CTD PMID:30510588 Itga7 Rat triptonide affects expression ISO Itga7 (Mus musculus) 6480464 triptonide affects the expression of ITGA7 mRNA CTD PMID:33045310 Itga7 Rat valproic acid decreases methylation ISO ITGA7 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ITGA7 gene CTD PMID:29154799 Itga7 Rat valproic acid increases expression ISO ITGA7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ITGA7 mRNA CTD PMID:23179753 more ...
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) Allylamine (EXP) alpha-Zearalanol (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) butanal (ISO) Butylbenzyl phthalate (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) carbon nanotube (ISO) chrysene (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) decabromodiphenyl ether (EXP) dexamethasone (ISO) dibutyl phthalate (EXP,ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) diquat (ISO) diuron (EXP) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) fenamidone (ISO) fipronil (EXP) flavonoids (EXP) flutamide (EXP) FR900359 (ISO) gentamycin (EXP) hydrogen peroxide (ISO) indometacin (ISO) lipopolysaccharide (ISO) maneb (ISO) monosodium L-glutamate (ISO) nickel atom (ISO) nickel sulfate (ISO) ochratoxin A (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) PhIP (EXP) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) progesterone (ISO) propanal (ISO) rotenone (EXP) sevoflurane (ISO) sodium arsenite (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) valproic acid (ISO)
1.
Transgenic expression of {alpha}7{beta}1 integrin maintains muscle integrity, increases regenerative capacity, promotes hypertrophy, and reduces cardiomyopathy in dystrophic mice.
Burkin DJ, etal., Am J Pathol. 2005 Jan;166(1):253-63.
2.
Modulation of alpha7-integrin-mediated adhesion and expression by platelet-derived growth factor in vascular smooth muscle cells.
Chao JT, etal., Am J Physiol Cell Physiol. 2006 Apr;290(4):C972-80. Epub 2005 Nov 9.
3.
Regulation of alpha7-integrin expression in vascular smooth muscle by injury-induced atherosclerosis.
Chao JT, etal., Am J Physiol Heart Circ Physiol. 2004 Jul;287(1):H381-9. Epub 2004 Feb 26.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Mutations in the integrin alpha7 gene cause congenital myopathy.
Hayashi YK, etal., Nat Genet. 1998 May;19(1):94-7.
7.
AAV-mediated overexpression of human a7 integrin leads to histological and functional improvement in dystrophic mice.
Heller KN, etal., Mol Ther. 2013 Mar;21(3):520-5. doi: 10.1038/mt.2012.281. Epub 2013 Jan 15.
8.
Absence of integrin alpha 7 causes a novel form of muscular dystrophy.
Mayer U, etal., Nat Genet. 1997 Nov;17(3):318-23. doi: 10.1038/ng1197-318.
9.
Gene Data Set
MGD Curation, June 12, 2002
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
13.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
H36-alpha 7 is a novel integrin alpha chain that is developmentally regulated during skeletal myogenesis.
Song WK, etal., J Cell Biol 1992 May;117(3):643-57.
18.
Expression of alpha 7 integrin cytoplasmic domains during skeletal muscle development: alternate forms, conformational change, and homologies with serine/threonine kinases and tyrosine phosphatases.
Song WK, etal., J Cell Sci 1993 Dec;106 ( Pt 4):1139-52.
19.
The integrins.
Takada Y, etal., Genome Biol. 2007;8(5):215.
20.
Cartilage oligomeric matrix protein maintains the contractile phenotype of vascular smooth muscle cells by interacting with alpha(7)beta(1) integrin.
Wang L, etal., Circ Res. 2010 Feb 19;106(3):514-25. doi: 10.1161/CIRCRESAHA.109.202762. Epub 2009 Dec 17.
Itga7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 1,944,447 - 1,973,347 (+) NCBI GRCr8 mRatBN7.2 7 1,360,125 - 1,388,886 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 1,359,940 - 1,388,450 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 4,124,517 - 4,151,033 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 6,000,177 - 6,026,675 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 6,301,622 - 6,327,909 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 3,355,079 - 3,383,886 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 3,355,116 - 3,384,675 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 3,325,268 - 3,354,361 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 2,230,747 - 2,269,403 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 2,230,888 - 2,269,401 (+) NCBI Celera 7 1,231,167 - 1,259,461 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
ITGA7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 55,684,568 - 55,716,400 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 55,684,568 - 55,716,404 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 56,078,352 - 56,106,192 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 54,364,619 - 54,387,894 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 54,364,622 - 54,387,894 NCBI Celera 12 55,730,824 - 55,758,560 (-) NCBI Celera Cytogenetic Map 12 q13.2 NCBI HuRef 12 53,117,170 - 53,144,908 (-) NCBI HuRef CHM1_1 12 56,045,138 - 56,072,879 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 55,651,197 - 55,683,036 (-) NCBI T2T-CHM13v2.0
Itga7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 128,769,633 - 128,794,155 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 128,769,645 - 128,794,155 (+) Ensembl GRCm39 Ensembl GRCm38 10 128,933,421 - 128,958,286 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 128,933,818 - 128,958,282 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 128,370,869 - 128,395,342 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 128,336,767 - 128,361,231 (+) NCBI MGSCv36 mm8 Celera 10 131,326,513 - 131,351,034 (+) NCBI Celera Cytogenetic Map 10 D3 NCBI cM Map 10 77.2 NCBI
Itga7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 3,321,259 - 3,343,275 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 3,322,735 - 3,343,275 (-) NCBI ChiLan1.0 ChiLan1.0
ITGA7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 38,612,270 - 38,643,474 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 38,609,040 - 38,640,051 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 33,195,602 - 33,226,796 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 33,923,549 - 33,950,892 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 33,923,549 - 33,950,886 (+) Ensembl panpan1.1 panPan2
ITGA7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 91,782 - 110,839 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 91,391 - 110,817 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 154,177 - 173,232 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 99,047 - 118,100 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 99,047 - 118,145 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 76,762 - 95,812 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 319,641 - 338,710 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 443,742 - 462,792 (-) NCBI UU_Cfam_GSD_1.0
Itga7
ITGA7
ITGA7
Itga7
.
Predicted Target Of
Count of predictions: 423 Count of miRNA genes: 225 Interacting mature miRNAs: 262 Transcripts: ENSRNOT00000030453, ENSRNOT00000048267, ENSRNOT00000061657 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
D7Uia7
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 1,363,523 - 1,363,728 (+) MAPPER mRatBN7.2 Rnor_6.0 7 3,358,656 - 3,358,860 NCBI Rnor6.0 Rnor_5.0 7 3,328,840 - 3,329,044 UniSTS Rnor5.0 RGSC_v3.4 7 2,234,144 - 2,234,348 UniSTS RGSC3.4 Celera 7 1,234,564 - 1,234,768 UniSTS Cytogenetic Map 7 q11 UniSTS
RH128213
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 1,388,522 - 1,388,731 (+) MAPPER mRatBN7.2 Rnor_6.0 7 3,383,523 - 3,383,731 NCBI Rnor6.0 Rnor_5.0 7 3,353,995 - 3,354,203 UniSTS Rnor5.0 RGSC_v3.4 7 2,269,040 - 2,269,248 UniSTS RGSC3.4 Celera 7 1,259,098 - 1,259,306 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
83
82
51
25
51
6
210
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030453 ⟹ ENSRNOP00000028983
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 3,355,116 - 3,384,675 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000061657 ⟹ ENSRNOP00000058370
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 1,359,940 - 1,388,450 (+) Ensembl Rnor_6.0 Ensembl 7 3,355,259 - 3,383,879 (+) Ensembl
RefSeq Acc Id:
NM_030842 ⟹ NP_110469
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,944,615 - 1,973,344 (+) NCBI mRatBN7.2 7 1,360,125 - 1,388,886 (+) NCBI Rnor_6.0 7 3,355,259 - 3,383,886 (+) NCBI Rnor_5.0 7 3,325,268 - 3,354,361 (+) NCBI RGSC_v3.4 7 2,230,747 - 2,269,403 (+) RGD Celera 7 1,231,167 - 1,259,461 (+) RGD
Sequence:
CGATTTCCTCGCATTAGCAGAGAGAGCGCGGAGCGTTGGTCCCATGGCCAGGATTCCGAGGTGCGATTTCCTCGGGCTCCCCGGAATTTGCTACCTTCTTAGTTTCTTGCTTGCCGGACTGCTCTTAC
hide sequence
RefSeq Acc Id:
XM_063264290 ⟹ XP_063120360
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,944,447 - 1,973,347 (+) NCBI
RefSeq Acc Id:
XM_063264291 ⟹ XP_063120361
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,944,448 - 1,973,347 (+) NCBI
RefSeq Acc Id:
XM_063264292 ⟹ XP_063120362
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,944,448 - 1,973,347 (+) NCBI
RefSeq Acc Id:
XM_063264293 ⟹ XP_063120363
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,952,011 - 1,973,347 (+) NCBI
RefSeq Acc Id:
XM_063264294 ⟹ XP_063120364
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,944,450 - 1,973,347 (+) NCBI
RefSeq Acc Id:
NP_110469 ⟸ NM_030842
- Peptide Label:
precursor
- UniProtKB:
Q63026 (UniProtKB/Swiss-Prot), Q5HZX9 (UniProtKB/Swiss-Prot), Q63027 (UniProtKB/Swiss-Prot), Q63258 (UniProtKB/Swiss-Prot), A0A8L2QS22 (UniProtKB/TrEMBL), A6KSL0 (UniProtKB/TrEMBL)
- Sequence:
MARIPRCDFLGLPGICYLLSFLLAGLLLPRASAFNLDVMGAIRKEGEPGSLFGFSVALHRQLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGANVQKESKENQWLGVSV
hide sequence
Ensembl Acc Id:
ENSRNOP00000058370 ⟸ ENSRNOT00000061657
Ensembl Acc Id:
ENSRNOP00000028983 ⟸ ENSRNOT00000030453
RefSeq Acc Id:
XP_063120360 ⟸ XM_063264290
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063120361 ⟸ XM_063264291
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2QS22 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120362 ⟸ XM_063264292
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063120364 ⟸ XM_063264294
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063120363 ⟸ XM_063264293
- Peptide Label:
isoform X4
RGD ID: 13694963 Promoter ID: EPDNEW_R5484 Type: initiation region Name: Itga7_1 Description: integrin subunit alpha 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R5485 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 3,355,121 - 3,355,181 EPDNEW
RGD ID: 13694960 Promoter ID: EPDNEW_R5485 Type: single initiation site Name: Itga7_2 Description: integrin subunit alpha 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R5484 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 3,355,238 - 3,355,298 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-23
Itga7
integrin subunit alpha 7
Itga7
integrin, alpha 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-02-09
Itga7
integrin, alpha 7
Itga7
integrin alpha 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-07-09
Itga7
integrin alpha 7
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_physical_interaction
associated with integrin beta 1
70774
gene_process
involved in the development of skeletal muscle
70773
