Symbol:
Lman1
Name:
lectin, mannose-binding, 1
RGD ID:
71020
Description:
Enables identical protein binding activity. Predicted to be involved in several processes, including Golgi organization; endoplasmic reticulum to Golgi vesicle-mediated transport; and negative regulation of protein targeting to mitochondrion. Predicted to act upstream of or within endoplasmic reticulum organization. Located in endoplasmic reticulum-Golgi intermediate compartment. Is active in glutamatergic synapse and postsynaptic Golgi apparatus. Human ortholog(s) of this gene implicated in factor V deficiency and factor XIII deficiency. Orthologous to human LMAN1 (lectin, mannose binding 1); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; protein secretory pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 2-methoxyethanol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
endoplasmic reticulum-golgi intermediate compartment protein 53; ER-Golgi intermediate compartment 53 kDa protein; lectin mannose-binding 1; p58; protein ERGIC-53
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LMAN1 (lectin, mannose binding 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Lman1 (lectin, mannose-binding, 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lman1 (lectin, mannose binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LMAN1 (lectin, mannose binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LMAN1 (lectin, mannose binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lman1 (lectin, mannose binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LMAN1 (lectin, mannose binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LMAN1 (lectin, mannose binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lman1 (lectin, mannose binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
LMAN1 (lectin, mannose binding 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Lman1 (lectin, mannose-binding, 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lman1 (lectin, mannose-binding, 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
EMP46
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
ergic53
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ile-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
EMP47
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
lman1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
wnt2b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cplx3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 61,778,971 - 61,800,960 (-) NCBI GRCr8 mRatBN7.2 18 59,508,996 - 59,530,873 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 59,508,996 - 59,530,851 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 61,604,527 - 61,624,705 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 62,303,213 - 62,323,391 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 60,131,092 - 60,151,186 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 61,683,377 - 61,707,344 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 61,685,117 - 61,707,317 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 60,880,943 - 60,901,877 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 62,504,296 - 62,524,151 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 62,577,496 - 62,597,352 (+) NCBI Celera 18 57,631,372 - 57,651,369 (-) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lman1 Rat 1,2-dimethylhydrazine multiple interactions ISO Lman1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LMAN1 mRNA CTD PMID:22206623 Lman1 Rat 1-nitropyrene increases expression ISO LMAN1 (Homo sapiens) 6480464 1-nitropyrene results in increased expression of LMAN1 mRNA CTD PMID:19041380 Lman1 Rat 17beta-estradiol decreases expression ISO Lman1 (Mus musculus) 6480464 Estradiol results in decreased expression of LMAN1 mRNA CTD PMID:19484750 Lman1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO LMAN1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of LMAN1 mRNA CTD PMID:29581250 Lman1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Lman1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of LMAN1 mRNA CTD PMID:15328365 and PMID:16611356 Lman1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LMAN1 mRNA CTD PMID:34747641 Lman1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO LMAN1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LMAN1 mRNA CTD PMID:23152189 Lman1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LMAN1 mRNA CTD PMID:20959002 and PMID:21724226 Lman1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lman1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LMAN1 mRNA CTD PMID:21570461 Lman1 Rat 2,6-dimethoxyphenol multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of LMAN1 protein CTD PMID:38598786 Lman1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of LMAN1 mRNA CTD PMID:21346803 Lman1 Rat 2-bromohexadecanoic acid multiple interactions ISO LMAN1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of LMAN1 protein] CTD PMID:38195004 Lman1 Rat 2-hydroxypropanoic acid decreases expression ISO LMAN1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of LMAN1 mRNA CTD PMID:30851411 Lman1 Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of LMAN1 mRNA CTD PMID:21061450 Lman1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Lman1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of LMAN1 mRNA CTD PMID:18648102 Lman1 Rat 4,4'-sulfonyldiphenol affects expression ISO Lman1 (Mus musculus) 6480464 bisphenol S affects the expression of LMAN1 mRNA CTD PMID:39298647 Lman1 Rat 4,4'-sulfonyldiphenol affects expression ISO LMAN1 (Homo sapiens) 6480464 bisphenol S affects the expression of LMAN1 protein CTD PMID:31945527 Lman1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of LMAN1 mRNA CTD PMID:36843608 Lman1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of LMAN1 mRNA CTD PMID:31881176 Lman1 Rat aflatoxin B1 decreases expression ISO Lman1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of LMAN1 mRNA CTD PMID:19770486 Lman1 Rat all-trans-retinoic acid decreases expression ISO LMAN1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of LMAN1 mRNA CTD PMID:33167477 Lman1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LMAN1 mRNA CTD PMID:16483693 Lman1 Rat aristolochic acid A decreases expression ISO LMAN1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of LMAN1 mRNA CTD PMID:33212167 Lman1 Rat Aroclor 1254 decreases expression ISO Lman1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of LMAN1 mRNA CTD PMID:23650126 Lman1 Rat arsane multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LMAN1 mRNA CTD PMID:39836092 Lman1 Rat arsenic atom multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LMAN1 mRNA CTD PMID:39836092 Lman1 Rat atrazine increases expression ISO LMAN1 (Homo sapiens) 6480464 Atrazine results in increased expression of LMAN1 mRNA CTD PMID:22378314 Lman1 Rat belinostat decreases expression ISO LMAN1 (Homo sapiens) 6480464 belinostat results in decreased expression of LMAN1 mRNA CTD PMID:26272509 Lman1 Rat benzo[a]pyrene increases expression ISO Lman1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of LMAN1 mRNA CTD PMID:22228805 Lman1 Rat benzo[a]pyrene decreases expression ISO Lman1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of LMAN1 mRNA CTD PMID:15034205 Lman1 Rat benzo[a]pyrene decreases expression ISO LMAN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of LMAN1 mRNA CTD PMID:20106945 and PMID:21632981 Lman1 Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of LMAN1 mRNA CTD PMID:16648578 Lman1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LMAN1 mRNA CTD PMID:25181051 Lman1 Rat bisphenol A decreases expression ISO LMAN1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of LMAN1 protein CTD PMID:34186270 Lman1 Rat bisphenol A increases expression ISO LMAN1 (Homo sapiens) 6480464 bisphenol A results in increased expression of LMAN1 mRNA and bisphenol A results in increased expression of LMAN1 protein CTD PMID:33670352 and PMID:37567409 Lman1 Rat bisphenol AF increases expression ISO LMAN1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of LMAN1 protein CTD PMID:34186270 Lman1 Rat Bisphenol B increases expression ISO LMAN1 (Homo sapiens) 6480464 bisphenol B results in increased expression of LMAN1 protein CTD PMID:34186270 Lman1 Rat bisphenol F increases expression ISO LMAN1 (Homo sapiens) 6480464 bisphenol F results in increased expression of LMAN1 protein CTD PMID:34186270 Lman1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of LMAN1 mRNA CTD PMID:24136188 Lman1 Rat cadmium atom multiple interactions ISO LMAN1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of LMAN1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of LMAN1 protein CTD PMID:38195004 Lman1 Rat cadmium dichloride multiple interactions ISO LMAN1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of LMAN1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of LMAN1 protein CTD PMID:38195004 Lman1 Rat carbon nanotube increases expression ISO Lman1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Lman1 Rat choline multiple interactions ISO Lman1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of LMAN1 gene CTD PMID:20938992 Lman1 Rat clofibrate decreases expression ISO Lman1 (Mus musculus) 6480464 Clofibrate results in decreased expression of LMAN1 mRNA CTD PMID:17585979 Lman1 Rat cyclosporin A increases expression ISO LMAN1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of LMAN1 mRNA CTD PMID:20106945 and PMID:27989131 Lman1 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of LMAN1 mRNA CTD PMID:16122865 Lman1 Rat diuron decreases expression ISO LMAN1 (Homo sapiens) 6480464 Diuron results in decreased expression of LMAN1 mRNA CTD PMID:35967413 Lman1 Rat dorsomorphin multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Lman1 Rat doxorubicin increases expression ISO LMAN1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of LMAN1 mRNA CTD PMID:29803840 Lman1 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of LMAN1 mRNA CTD PMID:29391264 and PMID:31464424 Lman1 Rat entinostat decreases expression ISO LMAN1 (Homo sapiens) 6480464 entinostat results in decreased expression of LMAN1 mRNA CTD PMID:26272509 Lman1 Rat entinostat multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LMAN1 mRNA CTD PMID:27188386 Lman1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of LMAN1 mRNA CTD PMID:15353170 Lman1 Rat folic acid multiple interactions ISO Lman1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Lman1 Rat formaldehyde decreases expression ISO LMAN1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of LMAN1 mRNA CTD PMID:23649840 Lman1 Rat furfural multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Lman1 Rat geldanamycin increases expression ISO LMAN1 (Homo sapiens) 6480464 geldanamycin results in increased expression of LMAN1 mRNA CTD PMID:26705709 Lman1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of LMAN1 mRNA CTD PMID:24136188 Lman1 Rat gold atom multiple interactions ISO Lman1 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of LMAN1 mRNA CTD PMID:19695318 Lman1 Rat gold(0) multiple interactions ISO Lman1 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of LMAN1 mRNA CTD PMID:19695318 Lman1 Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of LMAN1 mRNA CTD PMID:15159207 Lman1 Rat isoprenaline increases expression ISO Lman1 (Mus musculus) 6480464 Isoproterenol results in increased expression of LMAN1 mRNA CTD PMID:21823215 Lman1 Rat ivermectin decreases expression ISO LMAN1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of LMAN1 protein CTD PMID:32959892 Lman1 Rat L-methionine multiple interactions ISO Lman1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of LMAN1 gene CTD PMID:20938992 Lman1 Rat mercury dibromide decreases expression ISO LMAN1 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of LMAN1 mRNA CTD PMID:26272509 Lman1 Rat mercury dibromide multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LMAN1 mRNA CTD PMID:27188386 Lman1 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of LMAN1 protein CTD PMID:37182599 Lman1 Rat methyl methanesulfonate decreases expression ISO LMAN1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of LMAN1 mRNA CTD PMID:23649840 Lman1 Rat methylmercury chloride decreases expression ISO LMAN1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of LMAN1 mRNA CTD PMID:28001369 Lman1 Rat N-methyl-4-phenylpyridinium affects expression ISO LMAN1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of LMAN1 mRNA CTD PMID:12710931 Lman1 Rat N-methyl-4-phenylpyridinium multiple interactions ISO LMAN1 (Homo sapiens) 6480464 U 0126 affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of LMAN1 mRNA] CTD PMID:12710931 Lman1 Rat p-chloromercuribenzoic acid decreases expression ISO LMAN1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of LMAN1 mRNA CTD PMID:26272509 Lman1 Rat panobinostat decreases expression ISO LMAN1 (Homo sapiens) 6480464 panobinostat results in decreased expression of LMAN1 mRNA CTD PMID:26272509 Lman1 Rat panobinostat multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LMAN1 mRNA CTD PMID:27188386 Lman1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO LMAN1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of LMAN1 mRNA CTD PMID:27153767 Lman1 Rat phenobarbital affects expression ISO Lman1 (Mus musculus) 6480464 Phenobarbital affects the expression of LMAN1 mRNA CTD PMID:23091169 Lman1 Rat phenobarbital increases expression ISO LMAN1 (Homo sapiens) 6480464 Phenobarbital results in increased expression of LMAN1 protein CTD PMID:35881160 Lman1 Rat phenylmercury acetate decreases expression ISO LMAN1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of LMAN1 mRNA CTD PMID:26272509 Lman1 Rat phenylmercury acetate multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LMAN1 mRNA CTD PMID:27188386 Lman1 Rat pirinixic acid decreases expression ISO Lman1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of LMAN1 mRNA CTD PMID:23811191 Lman1 Rat propiconazole increases expression ISO Lman1 (Mus musculus) 6480464 propiconazole results in increased expression of LMAN1 mRNA CTD PMID:21278054 Lman1 Rat Propiverine affects binding EXP 6480464 propiverine binds to LMAN1 protein CTD PMID:29273565 Lman1 Rat quercetin decreases expression ISO LMAN1 (Homo sapiens) 6480464 Quercetin results in decreased expression of LMAN1 mRNA CTD PMID:21632981 Lman1 Rat rac-lactic acid decreases expression ISO LMAN1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of LMAN1 mRNA CTD PMID:30851411 Lman1 Rat SB 431542 multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Lman1 Rat sodium arsenite decreases expression ISO LMAN1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LMAN1 mRNA CTD PMID:28595984 Lman1 Rat sodium arsenite multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LMAN1 mRNA CTD PMID:39836092 Lman1 Rat sodium arsenite affects expression ISO LMAN1 (Homo sapiens) 6480464 sodium arsenite affects the expression of LMAN1 mRNA CTD PMID:34032870 Lman1 Rat sodium arsenite increases expression ISO LMAN1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of LMAN1 mRNA CTD PMID:38568856 Lman1 Rat sodium chloride multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of LMAN1 protein CTD PMID:38598786 Lman1 Rat sunitinib increases expression ISO LMAN1 (Homo sapiens) 6480464 Sunitinib results in increased expression of LMAN1 mRNA CTD PMID:31533062 Lman1 Rat testosterone decreases expression ISO Lman1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of LMAN1 mRNA CTD PMID:33848595 Lman1 Rat thapsigargin increases expression ISO LMAN1 (Homo sapiens) 6480464 Thapsigargin results in increased expression of LMAN1 mRNA CTD PMID:15292203 Lman1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of LMAN1 protein CTD PMID:35544339 Lman1 Rat titanium dioxide increases expression ISO Lman1 (Mus musculus) 6480464 titanium dioxide results in increased expression of LMAN1 mRNA CTD PMID:27760801 Lman1 Rat titanium dioxide decreases methylation ISO Lman1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of LMAN1 gene and titanium dioxide results in decreased methylation of LMAN1 promoter CTD PMID:35295148 Lman1 Rat trichostatin A decreases expression ISO LMAN1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of LMAN1 mRNA CTD PMID:24935251 and PMID:26272509 Lman1 Rat trichostatin A multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LMAN1 mRNA CTD PMID:27188386 Lman1 Rat trimellitic anhydride increases expression ISO Lman1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of LMAN1 mRNA CTD PMID:19042947 Lman1 Rat triphenyl phosphate affects expression ISO LMAN1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of LMAN1 mRNA CTD PMID:37042841 Lman1 Rat tunicamycin increases expression ISO Lman1 (Mus musculus) 6480464 Tunicamycin results in increased expression of LMAN1 mRNA CTD PMID:17127020 Lman1 Rat tunicamycin increases expression ISO LMAN1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of LMAN1 mRNA CTD PMID:22378314 Lman1 Rat ursodeoxycholic acid increases expression EXP 6480464 Ursodeoxycholic Acid results in increased expression of LMAN1 mRNA CTD PMID:15885361 Lman1 Rat valproic acid affects expression ISO Lman1 (Mus musculus) 6480464 Valproic Acid affects the expression of LMAN1 mRNA CTD PMID:17963808 Lman1 Rat valproic acid multiple interactions ISO LMAN1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of LMAN1 mRNA CTD PMID:27188386 Lman1 Rat valproic acid decreases expression ISO LMAN1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of LMAN1 mRNA CTD PMID:23179753 and PMID:26272509 Lman1 Rat valproic acid affects expression ISO LMAN1 (Homo sapiens) 6480464 Valproic Acid affects the expression of LMAN1 mRNA CTD PMID:25979313 Lman1 Rat valproic acid increases expression ISO LMAN1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of LMAN1 mRNA CTD PMID:23527032 and PMID:29154799 Lman1 Rat venlafaxine hydrochloride increases expression EXP 6480464 Venlafaxine Hydrochloride results in increased expression of LMAN1 mRNA CTD PMID:25423262 Lman1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of LMAN1 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 1-nitropyrene (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 2-methoxyethanol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bexarotene (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) choline (ISO) clofibrate (ISO) cyclosporin A (ISO) dimethylarsinic acid (EXP) diuron (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (EXP) folic acid (ISO) formaldehyde (ISO) furfural (ISO) geldanamycin (ISO) glafenine (EXP) gold atom (ISO) gold(0) (ISO) hexachlorobenzene (EXP) isoprenaline (ISO) ivermectin (ISO) L-methionine (ISO) mercury dibromide (ISO) Mesaconitine (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) propiconazole (ISO) Propiverine (EXP) quercetin (ISO) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) sunitinib (ISO) testosterone (ISO) thapsigargin (EXP,ISO) titanium dioxide (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) ursodeoxycholic acid (EXP) valproic acid (ISO) venlafaxine hydrochloride (EXP) vinclozolin (EXP)
Cellular Component
COPII-coated ER to Golgi transport vesicle (IBA,IEA,ISO) endomembrane system (IEA) endoplasmic reticulum (IEA,ISO) endoplasmic reticulum membrane (IBA,IEA) endoplasmic reticulum-Golgi intermediate compartment (IBA,IDA,IEA,ISO,TAS) endoplasmic reticulum-Golgi intermediate compartment membrane (IEA) glutamatergic synapse (IDA) Golgi apparatus (IEA,ISO) Golgi membrane (IBA,IEA) membrane (IEA) postsynaptic Golgi apparatus (IDA) sarcomere (IEA,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Synaptic activity and strength are reflected by changes in the post-synaptic secretory pathway.
Gürth CM, etal., Sci Rep. 2020 Nov 25;10(1):20576. doi: 10.1038/s41598-020-77260-2.
4.
Molecular cloning and expression of a 58-kDa cis-Golgi and intermediate compartment protein.
Lahtinen U, etal., J Biol Chem 1996 Feb 23;271(8):4031-7.
5.
Gene Data Set
MGD Curation, June 12, 2002
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
Oligomerization and interacellular localization of the glycoprotein receptor ERGIC-53 is independent of disulfide bonds.
Neve EP, etal., J Mol Biol. 2005 Dec 2;354(3):556-68. Epub 2005 Oct 12.
9.
ERGIC-53 gene structure and mutation analysis in 19 combined factors V and VIII deficiency families.
Nichols WC, etal., Blood 1999 Apr 1;93(7):2261-6.
10.
Mutations in the ER-Golgi intermediate compartment protein ERGIC-53 cause combined deficiency of coagulation factors V and VIII.
Nichols WC, etal., Cell. 1998 Apr 3;93(1):61-70.
11.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
UBXD4, a UBX-containing protein, regulates the cell surface number and stability of alpha3-containing nicotinic acetylcholine receptors.
Rezvani K, etal., J Neurosci. 2009 May 27;29(21):6883-96. doi: 10.1523/JNEUROSCI.4723-08.2009.
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Lectin control of protein folding and sorting in the secretory pathway.
Schrag JD, etal., Trends Biochem Sci 2003 Jan;28(1):49-57.
18.
Crystal structure of the carbohydrate recognition domain of p58/ERGIC-53, a protein involved in glycoprotein export from the endoplasmic reticulum.
Velloso LM, etal., J Biol Chem 2002 May 3;277(18):15979-84.
Lman1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 61,778,971 - 61,800,960 (-) NCBI GRCr8 mRatBN7.2 18 59,508,996 - 59,530,873 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 59,508,996 - 59,530,851 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 61,604,527 - 61,624,705 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 62,303,213 - 62,323,391 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 60,131,092 - 60,151,186 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 61,683,377 - 61,707,344 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 61,685,117 - 61,707,317 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 60,880,943 - 60,901,877 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 62,504,296 - 62,524,151 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 62,577,496 - 62,597,352 (+) NCBI Celera 18 57,631,372 - 57,651,369 (-) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
LMAN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 59,327,823 - 59,359,265 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 59,327,823 - 59,359,265 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 56,995,055 - 57,026,497 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 55,148,088 - 55,177,463 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 55,148,087 - 55,177,461 NCBI Celera 18 53,712,874 - 53,744,326 (-) NCBI Celera Cytogenetic Map 18 q21.32 NCBI HuRef 18 53,704,319 - 53,735,757 (-) NCBI HuRef CHM1_1 18 56,990,302 - 57,021,756 (-) NCBI CHM1_1 T2T-CHM13v2.0 18 59,529,314 - 59,560,731 (-) NCBI T2T-CHM13v2.0
Lman1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 66,113,810 - 66,135,706 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 66,113,809 - 66,155,651 (-) Ensembl GRCm39 Ensembl GRCm38 18 65,980,739 - 66,002,635 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 65,980,738 - 66,022,580 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 66,140,393 - 66,162,289 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 66,106,123 - 66,127,980 (-) NCBI MGSCv36 mm8 Celera 18 67,256,677 - 67,278,706 (-) NCBI Celera Cytogenetic Map 18 E1 NCBI cM Map 18 39.08 NCBI
Lman1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 43,464,722 - 43,496,048 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 43,465,556 - 43,495,789 (-) NCBI ChiLan1.0 ChiLan1.0
LMAN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 76,873,237 - 76,904,670 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 62,565,851 - 62,597,200 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 52,722,735 - 52,754,013 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 56,049,292 - 56,080,531 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 56,049,292 - 56,080,533 (-) Ensembl panpan1.1 panPan2
LMAN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 16,869,106 - 16,897,911 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 16,869,121 - 16,894,786 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 17,844,723 - 17,873,524 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 16,746,349 - 16,775,132 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 16,746,354 - 16,773,529 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 16,781,955 - 16,810,766 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 16,702,460 - 16,731,329 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 16,964,186 - 16,993,012 (+) NCBI UU_Cfam_GSD_1.0
Lman1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 30,144,591 - 30,169,193 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936497 5,383,524 - 5,408,452 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936497 5,383,636 - 5,409,347 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LMAN1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 161,607,143 - 161,631,651 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 161,607,122 - 161,631,650 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 179,184,985 - 179,209,552 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LMAN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 20,377,259 - 20,409,565 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 20,377,255 - 20,409,741 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666060 5,179,049 - 5,212,921 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lman1
.
Predicted Target Of
Count of predictions: 91 Count of miRNA genes: 78 Interacting mature miRNAs: 85 Transcripts: ENSRNOT00000032047 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1331730 Scl27 Serum cholesterol level QTL 27 3.826 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 18 52292875 59796643 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1331742 Bp228 Blood pressure QTL 228 3.88752 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 1331736 Bp227 Blood pressure QTL 227 2.791 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 46718763 59796643 Rat 1300125 Rf26 Renal function QTL 26 3.2 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 18 52539863 65844950 Rat 631834 Sach3 Saccharin preference QTL 3 3.9 0.01 consumption behavior trait (VT:0002069) calculated saccharin drink intake volume (CMO:0001600) 18 58805687 63636873 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 1331727 Bp237 Blood pressure QTL 237 3.053 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 61698465 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331774 Bp226 Blood pressure QTL 226 4.41065 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 61360 Eaey Experimental allergic encephalomyelitis QTL y 3 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 18 46988939 60377753 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 724542 Kidm2 Kidney mass QTL 2 2.6 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 18 59172115 83828827 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 2293658 Bmd23 Bone mineral density QTL 23 7.3 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 18 51464733 63636873 Rat 1359020 Ppulsi2 Prepulse inhibition QTL 2 2.71 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 18 52292875 73997283 Rat 2299160 Iddm35 Insulin dependent diabetes mellitus QTL 35 2.79 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 18 4207941 60377792 Rat 2312600 Bp341 Blood pressure QTL 341 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59330409 70263868 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1331752 Bw27 Body weight QTL 27 2.963 body mass (VT:0001259) body weight (CMO:0000012) 18 52292875 65845095 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 1331798 Bp224 Blood pressure QTL 224 3.53873 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 61383 Bp47 Blood pressure QTL 47 17.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 31271681 60377755 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 1331780 Bp238 Blood pressure QTL 238 3.269 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718763 59796643 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 1331776 Bp225 Blood pressure QTL 225 2.829 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 31359408 59796643 Rat 6903359 Bp355 Blood pressure QTL 355 3.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944544 59796478 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 6903345 Bp349 Blood pressure QTL 349 3.9 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 2313082 Bss85 Bone structure and strength QTL 85 0.8 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 18 14951337 59951337 Rat 6903347 Bp350 Blood pressure QTL 350 4.4 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359530 59796478 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 6903349 Bp351 Blood pressure QTL 351 3.5 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 631509 Sald2 Serum aldosterone level QTL 2 2.9 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 18 52539763 69140759 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 6903351 Bp352 Blood pressure QTL 352 3.3 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 1600375 Mcs22 Mammary carcinoma susceptibility QTL 22 3.3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 52539763 63933058 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 7411719 Strs5 Sensitivity to stroke QTL 5 9.4 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 18 49999958 65845095 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000032047 ⟹ ENSRNOP00000035966
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 18 61,685,117 - 61,707,317 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085784 ⟹ ENSRNOP00000070215
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 59,508,996 - 59,530,851 (-) Ensembl Rnor_6.0 Ensembl 18 61,686,401 - 61,707,307 (-) Ensembl
RefSeq Acc Id:
NM_053886 ⟹ NP_446338
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 61,780,711 - 61,800,820 (-) NCBI mRatBN7.2 18 59,510,736 - 59,530,848 (-) NCBI Rnor_6.0 18 61,685,117 - 61,707,317 (-) NCBI Rnor_5.0 18 60,880,943 - 60,901,877 (-) NCBI RGSC_v3.4 18 62,504,296 - 62,524,151 (+) RGD Celera 18 57,631,372 - 57,651,369 (-) RGD
Sequence:
AGAATCCAAGATGGCGGTGTCCAGGCGGCGGGGTCCCCAGGCTGGAGCGCAGTCGTTCTTCTGCGCCCTGCTGCTGTCTTTCAGCCAATTCGTCGGGAGCGACGGCATGGGAGGAGATGCTGCGGCTC
hide sequence
RefSeq Acc Id:
XM_039096545 ⟹ XP_038952473
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 61,778,971 - 61,800,960 (-) NCBI mRatBN7.2 18 59,508,996 - 59,530,873 (-) NCBI
RefSeq Acc Id:
XM_039096546 ⟹ XP_038952474
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 61,778,971 - 61,800,869 (-) NCBI mRatBN7.2 18 59,508,996 - 59,530,873 (-) NCBI
RefSeq Acc Id:
NP_446338 ⟸ NM_053886
- Peptide Label:
precursor
- UniProtKB:
Q62902 (UniProtKB/Swiss-Prot)
- Sequence:
MAVSRRRGPQAGAQSFFCALLLSFSQFVGSDGMGGDAAAPGAAGTQAELPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSADQIRIAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGA
hide sequence
Ensembl Acc Id:
ENSRNOP00000070215 ⟸ ENSRNOT00000085784
Ensembl Acc Id:
ENSRNOP00000035966 ⟸ ENSRNOT00000032047
RefSeq Acc Id:
XP_038952474 ⟸ XM_039096546
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038952473 ⟸ XM_039096545
- Peptide Label:
isoform X1
RGD ID: 13700836 Promoter ID: EPDNEW_R11360 Type: multiple initiation site Name: Lman1_1 Description: lectin, mannose-binding, 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 61,707,317 - 61,707,377 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-07-09
Lman1
lectin, mannose-binding, 1
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localized to the endoplasmic reticulum (ER) and the Golgi complex
727344
gene_disease
contains a carbohydrate recognition domain
727344
