Advanced Search (OLGA)

Gene: Ascl1 (achaete-scute family bHLH transcription factor 1) Rattus norvegicus

Analyze

Symbol:

Ascl1

Name:

achaete-scute family bHLH transcription factor 1

RGD ID:

71010

Description:

Enables double-stranded DNA binding activity and identical protein binding activity. Involved in several processes, including cellular response to magnetism; regulation of neuron differentiation; and response to retinoic acid. Predicted to be located in neuronal cell body and nucleus. Predicted to be part of RNA polymerase II transcription regulator complex. Biomarker of status epilepticus. Orthologous to human ASCL1 (achaete-scute family bHLH transcription factor 1); INTERACTS WITH (S)-nicotine; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

achaete-scute complex (Drosophila) homolog-like 1; achaete-scute complex homolog 1; achaete-scute complex homolog 1 (Drosophila); achaete-scute complex homolog-like 1; achaete-scute complex homolog-like 1 (Drosophila); achaete-scute homolog 1; Mash1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ASCL1 (achaete-scute family bHLH transcription factor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ascl1 (achaete-scute family bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ascl1 (achaete-scute family bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ASCL1 (achaete-scute family bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ASCL1 (achaete-scute family bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ascl1 (achaete-scute family bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ASCL1 (achaete-scute family bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ASCL1 (achaete-scute family bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ascl1 (achaete-scute family bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ascl1 (achaete-scute family bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Ascl1 (achaete-scute family bHLH transcription factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ASCL1 (achaete-scute family bHLH transcription factor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ascl1a (achaete-scute family bHLH transcription factor 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ascl1a (achaete-scute family bHLH transcription factor 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	ascl1b (achaete-scute family bHLH transcription factor 1b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	ase	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	hlh-14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	hlh-14	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	hlh-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder)
Caenorhabditis elegans (roundworm):	hlh-3	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	l(1)sc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	l(1)sc	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	sc	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	ascl1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ascl1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	23,790,642 - 23,793,509 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	23,790,360 - 23,798,231 (-)	Ensembl				GRCr8
mRatBN7.2	7	21,903,136 - 21,906,003 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	21,903,126 - 21,905,993 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	23,897,825 - 23,900,692 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	26,060,505 - 26,063,372 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	25,837,585 - 25,840,452 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	28,038,662 - 28,040,504 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	28,038,662 - 28,040,510 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	28,152,425 - 28,154,275 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	24,145,578 - 24,168,494 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	19,079,344 - 19,081,186 (-)	NCBI		Celera
RGSC_v3.1	7	24,165,848 - 24,167,679 (-)	NCBI
Cytogenetic Map	7	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acute Lung Injury (ISO)

Hyperplasia (IDA)

intellectual disability (ISO)

lung small cell carcinoma (ISO)

nervous system disease (ISO)

status epilepticus (IEP)

stroke (IDA)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP)

1,8-cineole (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

Actein (EXP)

afimoxifene (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

all-trans-retinol (EXP)

ammonium chloride (EXP)

arotinoid acid (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Bisphenol Z (ISO)

bosentan (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

CHIR 99021 (ISO)

cortisol (ISO)

Cyclopamine (EXP)

D-glucose (ISO)

decabromodiphenyl ether (EXP)

deguelin (ISO)

deoxycholic acid (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

ellagic acid (ISO)

ethanol (ISO)

fructose (ISO)

glucose (ISO)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

ketamine (EXP)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

maneb (ISO)

methylmercury chloride (ISO)

naphthalene (ISO)

nicotine (EXP)

nitrofen (EXP)

ochratoxin A (EXP)

okadaic acid (ISO)

panobinostat (ISO)

paraquat (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

poly(ethylene) (ISO)

propionic acid (ISO)

resveratrol (ISO)

sarin (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

tamoxifen (EXP)

tetrachloromethane (EXP)

thapsigargin (ISO)

titanium dioxide (ISO)

tributylstannane (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

uranium atom (EXP)

valproic acid (EXP,ISO)

venlafaxine hydrochloride (EXP)

vinclozolin (EXP)

vorinostat (ISO)

XAV939 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adrenal chromaffin cell differentiation (ISO)

carotid body glomus cell differentiation (ISO)

cell differentiation (IEA,ISO)

cell maturation (ISO)

cellular response to magnetism (IEP)

central nervous system neuron development (ISO)

cerebral cortex development (ISO)

cerebral cortex GABAergic interneuron differentiation (IEA,ISO)

commitment of neuronal cell to specific neuron type in forebrain (ISO)

forebrain neuron differentiation (IDA)

generation of neurons (ISO)

glial cell differentiation (ISO)

heart development (IEP)

lung neuroendocrine cell differentiation (ISO)

musculoskeletal movement, spinal reflex action (ISO)

negative regulation of apoptotic process (IEA,ISO)

negative regulation of DNA-templated transcription (IEA,ISO)

negative regulation of neuron differentiation (IDA,IEA,ISO)

negative regulation of transcription by RNA polymerase II (IEA,ISO)

nervous system development (IDA,IEA,ISO)

neuroblast fate determination (ISO)

neuroblast proliferation (ISO)

neurogenesis (IEA,ISO)

neuron development (IEA,ISO,ISS)

neuron differentiation (IBA,IEA,ISO)

neuron fate commitment (IEA,ISO,ISS)

neuron fate specification (IEA,ISO,ISS)

neuron migration (ISO)

noradrenergic neuron development (IEA,ISO,ISS)

noradrenergic neuron fate commitment (IEA,ISO)

Notch signaling pathway (IEA,ISO)

olfactory pit development (ISO)

oligodendrocyte cell fate commitment (ISO)

oligodendrocyte development (ISO)

oligodendrocyte differentiation (ISO)

pattern specification process (ISO)

positive regulation of cell cycle (ISO)

positive regulation of neural precursor cell proliferation (ISO)

positive regulation of neurogenesis (ISO)

positive regulation of neuron apoptotic process (ISO)

positive regulation of neuron differentiation (IDA)

positive regulation of Notch signaling pathway (ISO)

positive regulation of transcription by RNA polymerase II (IBA,IEA,ISO)

regulation of cell differentiation (IEA)

regulation of cell population proliferation (ISO)

regulation of epithelial cell differentiation (ISO)

regulation of gene expression (ISO,ISS)

regulation of mitotic cell cycle (ISO)

regulation of neurogenesis (IBA,ISO)

regulation of Notch signaling pathway (ISO)

regulation of timing of subpallium neuron differentiation (ISO)

regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

response to epidermal growth factor (IEP)

response to folic acid (IEP)

response to retinoic acid (IEA,IEP,ISO)

sensory organ development (IBA)

spinal cord association neuron differentiation (ISO)

spinal cord oligodendrocyte cell differentiation (ISO)

spinal cord oligodendrocyte cell fate specification (ISO)

stomach neuroendocrine cell differentiation (ISO)

subpallium neuron fate commitment (ISO)

sympathetic ganglion development (IEA,ISO,ISS)

ventral spinal cord interneuron fate commitment (IEA,ISO,ISS)

vestibular nucleus development (ISO)

Cellular Component

neuronal cell body (IEA,ISO)

nucleoplasm (TAS)

nucleus (IEA,ISO)

RNA polymerase II transcription regulator complex (IBA)

Molecular Function

bHLH transcription factor binding (IEA,ISO)

chromatin binding (IEA,ISO)

DNA binding (IEA)

DNA-binding transcription factor activity (IEA,ISO,ISS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO)

double-stranded DNA binding (IDA)

E-box binding (IEA,ISO)

identical protein binding (IPI)

nucleic acid binding (ISO)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Involvement of Mash1 in EGF-mediated regulation of differentiation in the vertebrate retina.	Ahmad I, etal., Dev Biol. 1998 Feb 1;194(1):86-98.
2.	Vitamin A deficiency leads to increased cell proliferation in olfactory epithelium of mature rats.	Asson-Batres MA, etal., J Neurobiol 2003 Mar;54(4):539-54.
3.	Vascular endothelial growth factor mediates atorvastatin-induced mammalian achaete-scute homologue-1 gene expression and neuronal differentiation after stroke in retired breeder rats.	Chen J, etal., Neuroscience. 2006 Aug 25;141(2):737-44. Epub 2006 May 30.
4.	Differential regulation of basic helix-loop-helix mRNAs in the dentate gyrus following status epilepticus.	Elliott RC, etal., Neuroscience. 2001;106(1):79-88.
5.	Generation of neurons by transient expression of neural bHLH proteins in mammalian cells.	Farah MH, etal., Development. 2000 Feb;127(4):693-702.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Mammalian achaete-scute homolog 1 is required for the early development of olfactory and autonomic neurons.	Guillemot F, etal., Cell 1993 Nov 5;75(3):463-76.
9.	Contrasting and brain region-specific roles of neurogenin2 and mash1 in GABAergic neuron differentiation in vitro.	Jo AY, etal., Exp Cell Res. 2007 Nov 15;313(19):4066-81. Epub 2007 Sep 8.
10.	Two rat homologues of Drosophila achaete-scute specifically expressed in neuronal precursors.	Johnson JE, etal., Nature 1990 Aug 30;346(6287):858-61.
11.	Thermodynamics of the DNA binding reaction of transcription factor MASH-1.	K-unne AG, etal., Biochemistry. 1998 Mar 24;37(12):4217-23.
12.	Lithium ions: a novel treatment for pheochromocytomas and paragangliomas.	Kappes A, etal., Surgery. 2007 Feb;141(2):161-5; discussion 165.
13.	Mammalian achaete scute homolog 2 is expressed in the adult sciatic nerve and regulates the expression of Krox24, Mob-1, CXCR4, and p57kip2 in Schwann cells.	Kury P, etal., J Neurosci 2002 Sep 1;22(17):7586-95.
14.	Comparison of the generic neuronal differentiation and neuron subtype specification functions of mammalian achaete-scute and atonal homologs in cultured neural progenitor cells.	Lo L, etal., Development 2002 Apr;129(7):1553-67.
15.	Gene Data Set	MGD Curation, June 12, 2002
16.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
17.	Possible promotion of neuronal differentiation in fetal rat brain neural progenitor cells after sustained exposure to static magnetism.	Nakamichi N, etal., J Neurosci Res. 2009 Aug 15;87(11):2406-17.
18.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
20.	GOA pipeline	RGD automated data pipeline
21.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
23.	Retinoic acid influences the expression of the neuronal regulatory genes Mash-1 and c-ret in the developing rat heart.	Shoba T, etal., Neurosci Lett 2002 Feb 1;318(3):129-32.
24.	Effects of folate on notch signaling and cell proliferation in neural stem cells of neonatal rats in vitro.	Zhang X, etal., J Nutr Sci Vitaminol (Tokyo). 2008 Oct;54(5):353-6.

Additional References at PubMed

PMID:1576967	PMID:8845150	PMID:8900141	PMID:9108377	PMID:9126746	PMID:9876181	PMID:10903890	PMID:10952889	PMID:11032813	PMID:11073877	PMID:11133151	PMID:11736660
PMID:11940670	PMID:12000752	PMID:12050665	PMID:12361965	PMID:12397111	PMID:12629181	PMID:12858003	PMID:12885554	PMID:14532329	PMID:15065125	PMID:15071116	PMID:15133515
PMID:15169849	PMID:15854743	PMID:15878769	PMID:15930101	PMID:15976074	PMID:16020526	PMID:16160079	PMID:16469766	PMID:16715081	PMID:16723737	PMID:16766700	PMID:17141158
PMID:17488716	PMID:17507989	PMID:17678855	PMID:17727826	PMID:18094025	PMID:18173746	PMID:18184563	PMID:18287202	PMID:18311112	PMID:18781144	PMID:19008346	PMID:19097999
PMID:19191219	PMID:19399893	PMID:19793887	PMID:19796622	PMID:20144606	PMID:20599619	PMID:21536733	PMID:22583763	PMID:22991444	PMID:23284756	PMID:23434913	PMID:23616538
PMID:23639443	PMID:23792135	PMID:24144723	PMID:24243019	PMID:25124043	PMID:25751153	PMID:26437572	PMID:28276447	PMID:31317490	PMID:33631250	PMID:37385615

Genomics

Comparative Map Data

Ascl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	23,790,642 - 23,793,509 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	23,790,360 - 23,798,231 (-)	Ensembl				GRCr8
mRatBN7.2	7	21,903,136 - 21,906,003 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	21,903,126 - 21,905,993 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	23,897,825 - 23,900,692 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	26,060,505 - 26,063,372 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	25,837,585 - 25,840,452 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	28,038,662 - 28,040,504 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	28,038,662 - 28,040,510 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	28,152,425 - 28,154,275 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	24,145,578 - 24,168,494 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	19,079,344 - 19,081,186 (-)	NCBI		Celera
RGSC_v3.1	7	24,165,848 - 24,167,679 (-)	NCBI
Cytogenetic Map	7	q13	NCBI

ASCL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	102,957,674 - 102,960,513 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	102,957,674 - 102,960,513 (+)	Ensembl			hg38	GRCh38
GRCh37	12	103,351,452 - 103,354,291 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	101,875,594 - 101,878,421 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	101,853,930 - 101,856,754	NCBI
Celera	12	103,015,725 - 103,018,566 (+)	NCBI		Celera
Cytogenetic Map	12	q23.2	NCBI
HuRef	12	100,410,703 - 100,413,544 (+)	NCBI		HuRef
CHM1_1	12	103,318,246 - 103,321,086 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	102,918,498 - 102,921,335 (+)	NCBI		T2T-CHM13v2.0

Ascl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	87,326,681 - 87,329,522 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	87,326,681 - 87,329,522 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	87,490,819 - 87,493,660 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	87,490,819 - 87,493,660 (-)	Ensembl			mm10	GRCm38
MGSCv37	10	86,953,786 - 86,956,405 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	86,920,621 - 86,922,980 (-)	NCBI		MGSCv36	mm8
Celera	10	89,464,389 - 89,467,010 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	43.64	NCBI

Ascl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	37,941,243 - 37,943,641 (+)	Ensembl
ChiLan1.0	NW_004955405	37,941,243 - 37,943,641 (+)	NCBI	ChiLan1.0	ChiLan1.0

ASCL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	111,022,772 - 111,025,613 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	111,019,172 - 111,022,010 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	100,536,895 - 100,539,737 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	103,931,707 - 103,934,554 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	103,932,302 - 103,932,999 (+)	Ensembl			panPan2	panpan1.1

ASCL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	41,694,021 - 41,696,933 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	41,694,269 - 41,695,391 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	42,062,179 - 42,065,075 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	42,349,900 - 42,352,808 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	15	41,619,328 - 41,622,224 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	41,717,251 - 41,720,147 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	41,986,771 - 41,989,679 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ascl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	18,304,396 - 18,306,779 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	11,316,417 - 11,317,166 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	11,315,929 - 11,317,166 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ASCL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	81,358,969 - 81,359,673 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	81,357,431 - 81,360,335 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ASCL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	98,182,213 - 98,185,057 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	98,182,787 - 98,183,506 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	146,827,687 - 146,830,550 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ascl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	5,487,053 - 5,493,339 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624750	5,487,046 - 5,489,399 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ascl1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	166,595,577 - 166,596,878 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ascl1
15 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	43
Count of miRNA genes:	41
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000005674
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354644	Spl4	Serum phospholipid level QTL 4	4.9		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	7	21541977	51639954	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	7216097	52216097	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	10517086	62346019	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1709527	46709527	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	10112916	60150541	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	9460877	54460877	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	29716167	Rat
1354637	Scl30	Serum cholesterol level QTL 30	3.7		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	7	21541977	51639954	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34650782	Rat
1354639	Spl5	Serum phospholipid level QTL 5	3.9		blood LDL phospholipid amount (VT:0010505)	blood low density lipoprotein phospholipid level (CMO:0001568)	7	21541977	35707405	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	32612984	Rat
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1669658	46669658	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
2290372	Gluco33	Glucose level QTL 33	2.71		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	1	31777942	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	32612984	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	21541977	86817926	Rat
1300138	Hrtrt9	Heart rate QTL 9	4.72		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	10498820	55498820	Rat
61369	Mcs2	Mammary carcinoma susceptibility QTL 2	3.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	20920494	37412865	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	17460447	62460447	Rat
70207	Niddm31	Non-insulin dependent diabetes mellitus QTL 31	3.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	20057232	65057232	Rat

Markers in Region

Ascl1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	21,904,669 - 21,905,151 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	28,039,179 - 28,039,660	NCBI	Rnor6.0
Rnor_5.0	7	28,152,942 - 28,153,423	UniSTS	Rnor5.0
RGSC_v3.4	7	24,146,095 - 24,146,576	UniSTS	RGSC3.4
Celera	7	19,079,861 - 19,080,342	UniSTS
Cytogenetic Map	7	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	4	15	136	62	61	30	11	30	4	115	51	6	115	15	58	31	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X53725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005674 ⟹ ENSRNOP00000005674

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	21,903,126 - 21,905,993 (-)	Ensembl
Rnor_6.0 Ensembl	7	28,038,662 - 28,040,510 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000162977 ⟹ ENSRNOP00000107713

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	23,790,360 - 23,798,231 (-)	Ensembl

RefSeq Acc Id:

NM_022384 ⟹ NP_071779

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	23,790,642 - 23,793,509 (-)	NCBI
mRatBN7.2	7	21,903,136 - 21,906,003 (-)	NCBI
Rnor_6.0	7	28,038,662 - 28,040,504 (-)	NCBI
Rnor_5.0	7	28,152,425 - 28,154,275 (-)	NCBI
RGSC_v3.4	7	24,145,578 - 24,168,494 (-)	RGD
Celera	7	19,079,344 - 19,081,186 (-)	RGD

Sequence:

show sequence

TGCGCCGCCTCCTCCCTCCCCTCCTCCCGCCGCGGTTGGCTTCGGGAGCCTCGCGTGGCGCTCG
CGTGTGCGGCCGCCGCCGGCGCCTTCTCGGTTTTAAAAGAGGAAAGGGAAAAGGAAAGCAGCCG
CAAAAGTCAGCGCCGAGCGTGCTCTGCCAGGTCGAGCCGCTCCCGGCAGCACTCTCTCACTTCT
GGCCAGGGAACGTGGAAGGCGTACCGGCTAGGAGCCGGTTAGGGAGGGCGAATTGGGGGACGAA
AGAGGAATTAGAAAGAAAGGGGGTTCAGCCAAATAATCCCAGAAGTAGGCTCAAGCCCAGACTG
GAGCAGGGGAGAGCGAGCGCAAGAGAGCGCAGTCCGGGAGCGGCTCGACCTGGCAGAGCACGCT
CGGCGCTGACTTTTGCGGCTGCTTTCCTTTTCCCTTTCCTCTTTTAAAACCGAGAAGGCGCCGG
CGCCGCACACGCGAGCGCCACGCGAGGCTCCCGAAGCCAACCGCGGCGGGAGGAGGGGAGGGAG
GAGGCGGCGCAGAGGGAAGACGATCACCCAGGCACCTTCCTCCGTTGCTGCTAGACAACTCTGC
CTCCTTCTGCGCGTTTCTTCCCTTTTAACTTTCCTCCGGGGCTGGTTTCTCCCCTCTTCTTTTT
CTTCGCCCCCTTTGATCGTGCTTCGCAGTCCCGCTTCCTTCTAGCTCTCTGCGTCCCCTGAGTC
CCCAACTCGTTCTCCCCCGCGACAGTTTGGGCCAGCATGGAGAGCTCTGGCAAGATGGAGAGCG
GAGCCGGCCAGCAGCCGCAGCCTCCGCAGCCCTTCCTGCCGCCTGCAGCCTGCTTCTTTGCGAC
CGCGGCGGCCGCGGCGGCGGCGGCGGCGGCAGCGGCAGCTCAGAGCGCGCAGCAGCAACAGCAG
CAGCAGGCGCCGCAGCAGCAGGCGCCGCAGCTGAGCCCGGTGGCGGACGGCCAGCCCTCAGGGG
GCGGTCACAAGTCAGCGGCCAAGCAGGTCAAGCGCCAGCGCTCGTCCTCTCCCGAACTGATGCG
CTGCAAACGCCGGCTCAACTTCAGTGGCTTCGGCTACAGCCTTCCACAGCAGCAGCCGGCAGCC
GTGGCGCGCCGCAACGAGCGCGAGCGCAACCGGGTCAAGTTGGTTAACCTGGGCTTTGCCACCC
TCCGGGAGCATGTCCCCAACGGCGCTGCCAACAAGAAGATGAGCAAGGTGGAGACGCTGCGTTC
GGCGGTCGAATACATCCGCGCGCTGCAGCAGCTGCTGGACGAGCACGATGCGGTGAGCGCTGCC
TTCCAGGCGGGCGTCCTGTCGCCCACCATCTCCCCCAACTACTCCAACGACTTGAACTCTATGG
CGGGTTCTCCGGTTTCGTCCTACTCCTCCGACGAGGGATCCTACGACCCCCTTAGTCCAGAGGA
ACAAGAGCTGCTGGACTTTACCAACTGGTTCTGAGGGGCTGACAGGCCCTACTGGGAATGGACT
TTGGAAGCAGGATGGCAGGAGATCCTGTGTCTTCAGTGTTTCTTGACAACGACGTCAAAAGGGG
GAGGCAGAAAAAAAAAAACAAGGGAAGAGGAAAAGAAACAAACAAACCAGACACCCAGCCTCCC
ACGGGCACCAGGACTTAGATTCAATGTTCTCAGCAACAGGGGTGGGCTCCAACAGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_071779	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA37760	(Get FASTA)	NCBI Sequence Viewer
	EDM17037	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005674.2
	ENSRNOP00000107713
GenBank Protein	P19359	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071779 ⟸ NM_022384

- UniProtKB:

P19359 (UniProtKB/Swiss-Prot), A6IFL1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MESSGKMESGAGQQPQPPQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQAPQQQAPQLS
PVADGQPSGGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRV
KLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISP
NYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF

hide sequence

Ensembl Acc Id:

ENSRNOP00000005674 ⟸ ENSRNOT00000005674

Ensembl Acc Id:

ENSRNOP00000107713 ⟸ ENSRNOT00000162977

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P19359-F1-model_v2	AlphaFold	P19359	1-233	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695118

Promoter ID:

EPDNEW_R5643

Type:

single initiation site

Name:

Ascl1_1

Description:

achaete-scute family bHLH transcription factor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	28,040,491 - 28,040,551	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71010	AgrOrtholog
BioCyc Gene	G2FUF-34529	BioCyc
Ensembl Genes	ENSRNOG00000004294	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000085519	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000005674.6	UniProtKB/Swiss-Prot
	ENSRNOT00000162977	ENTREZGENE
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot
InterPro	bHLH_dom	UniProtKB/Swiss-Prot
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot
	MASH1/Ascl1a-like	UniProtKB/Swiss-Prot
KEGG Report	rno:64186	UniProtKB/Swiss-Prot
NCBI Gene	64186	ENTREZGENE
PANTHER	ACHAETE-SCUTE HOMOLOG 1	UniProtKB/Swiss-Prot
	ACHAETE-SCUTE TRANSCRIPTION FACTOR-RELATED	UniProtKB/Swiss-Prot
Pfam	HLH	UniProtKB/Swiss-Prot
PhenoGen	Ascl1	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004294	RatGTEx
	ENSRNOG00000085519	RatGTEx
SMART	HLH	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot
UniProt	A6IFL1	ENTREZGENE, UniProtKB/TrEMBL
	ASCL1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-11-11	Ascl1	achaete-scute family bHLH transcription factor 1	Ascl1	achaete-scute complex homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-15	Ascl1	achaete-scute complex homolog 1 (Drosophila)	Ascl1	achaete-scute complex homolog-like 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Ascl1	achaete-scute complex homolog-like 1 (Drosophila)			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD