Symbol:
Hpcal4
Name:
hippocalcin-like 4
RGD ID:
708491
Description:
Enables calcium channel regulator activity and protein domain specific binding activity. Predicted to be involved in regulation of signal transduction. Orthologous to human HPCAL4 (hippocalcin like 4); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
hippocalcin-like protein 4; neural visinin-like Ca2+-binding protein type 2; neural visinin-like protein 2; Nvjp2; NVL-2; NVP-2; VILIP-2; visinin-like protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HPCAL4 (hippocalcin like 4) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Hpcal4 (hippocalcin-like 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hpcal4 (hippocalcin like 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HPCAL4 (hippocalcin like 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HPCAL4 (hippocalcin like 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hpcal4 (hippocalcin like 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HPCAL4 (hippocalcin like 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HPCAL4 (hippocalcin like 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hpcal4 (hippocalcin like 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
HPCAL4 (hippocalcin like 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Hpcal4 (hippocalcin-like 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hpcal4 (hippocalcin like 4)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
FRQ1
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
CG7646
Alliance
DIOPT (Ensembl Compara|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 140,739,577 - 140,751,529 (+) NCBI GRCr8 mRatBN7.2 5 135,454,477 - 135,466,417 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 135,454,540 - 135,466,416 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 138,161,114 - 138,168,988 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 139,931,081 - 139,938,951 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 139,938,218 - 139,946,092 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 140,870,127 - 140,882,242 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 140,870,140 - 140,882,244 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 144,660,294 - 144,672,321 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 142,490,462 - 142,498,359 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 142,495,687 - 142,503,585 (+) NCBI Celera 5 133,994,080 - 134,001,954 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hpcal4 Rat (S)-nicotine increases expression ISO HPCAL4 (Homo sapiens) 6480464 Nicotine results in increased expression of HPCAL4 mRNA CTD PMID:23825647 Hpcal4 Rat 1,2-dimethylhydrazine increases expression ISO Hpcal4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of HPCAL4 mRNA CTD PMID:22206623 Hpcal4 Rat 17alpha-ethynylestradiol multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HPCAL4 mRNA CTD PMID:17942748 Hpcal4 Rat 17alpha-ethynylestradiol increases expression ISO Hpcal4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of HPCAL4 mRNA CTD PMID:17942748 Hpcal4 Rat 17beta-estradiol multiple interactions ISO HPCAL4 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of HPCAL4 mRNA CTD PMID:30165855 Hpcal4 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Hpcal4 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Hpcal4 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Hpcal4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HPCAL4 mRNA CTD PMID:17942748 Hpcal4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HPCAL4 mRNA CTD PMID:33387578 Hpcal4 Rat 2-methylcholine affects expression ISO HPCAL4 (Homo sapiens) 6480464 beta-methylcholine affects the expression of HPCAL4 mRNA CTD PMID:21179406 Hpcal4 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Hpcal4 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of HPCAL4 mRNA CTD PMID:20188158 Hpcal4 Rat 3-methylcholanthrene increases expression ISO Hpcal4 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of HPCAL4 mRNA CTD PMID:25926378 Hpcal4 Rat 4,4'-sulfonyldiphenol increases methylation ISO Hpcal4 (Mus musculus) 6480464 bisphenol S results in increased methylation of HPCAL4 exon CTD PMID:33297965 Hpcal4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of HPCAL4 mRNA CTD PMID:24780913 Hpcal4 Rat aflatoxin B1 increases methylation ISO HPCAL4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of HPCAL4 gene and Aflatoxin B1 results in increased methylation of HPCAL4 intron CTD PMID:27153756 and PMID:30157460 Hpcal4 Rat Aflatoxin B2 alpha decreases methylation ISO HPCAL4 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of HPCAL4 intron CTD PMID:30157460 Hpcal4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HPCAL4 mRNA CTD PMID:16483693 Hpcal4 Rat antirheumatic drug decreases expression ISO HPCAL4 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of HPCAL4 mRNA CTD PMID:24449571 Hpcal4 Rat benzo[a]pyrene multiple interactions ISO Hpcal4 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of HPCAL4 mRNA] CTD PMID:22228805 Hpcal4 Rat benzo[a]pyrene affects methylation ISO HPCAL4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HPCAL4 5' UTR and Benzo(a)pyrene affects the methylation of HPCAL4 intron CTD PMID:27901495 and PMID:30157460 Hpcal4 Rat benzo[a]pyrene increases methylation ISO HPCAL4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of HPCAL4 3' UTR and Benzo(a)pyrene results in increased methylation of HPCAL4 promoter CTD PMID:27901495 Hpcal4 Rat benzo[a]pyrene decreases expression ISO Hpcal4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of HPCAL4 mRNA CTD PMID:22228805 Hpcal4 Rat benzo[b]fluoranthene increases expression ISO Hpcal4 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of HPCAL4 mRNA CTD PMID:26377693 Hpcal4 Rat bis(2-ethylhexyl) phthalate increases expression ISO Hpcal4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of HPCAL4 mRNA CTD PMID:34319233 Hpcal4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HPCAL4 mRNA CTD PMID:25181051 Hpcal4 Rat bisphenol A increases expression ISO HPCAL4 (Homo sapiens) 6480464 bisphenol A results in increased expression of HPCAL4 mRNA CTD PMID:36232920 Hpcal4 Rat bisphenol A decreases expression ISO Hpcal4 (Mus musculus) 6480464 bisphenol A results in decreased expression of HPCAL4 mRNA CTD PMID:32156529 Hpcal4 Rat bisphenol A decreases methylation ISO HPCAL4 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of HPCAL4 gene CTD PMID:31601247 Hpcal4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HPCAL4 mRNA CTD PMID:30816183 more ... Hpcal4 Rat bisphenol A decreases methylation ISO Hpcal4 (Mus musculus) 6480464 bisphenol A results in decreased methylation of HPCAL4 promoter CTD PMID:27312807 Hpcal4 Rat butanal increases expression ISO HPCAL4 (Homo sapiens) 6480464 butyraldehyde results in increased expression of HPCAL4 mRNA CTD PMID:26079696 Hpcal4 Rat CGP 52608 multiple interactions ISO HPCAL4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to HPCAL4 gene] CTD PMID:28238834 Hpcal4 Rat chloroprene decreases expression ISO Hpcal4 (Mus musculus) 6480464 Chloroprene results in decreased expression of HPCAL4 mRNA CTD PMID:23125180 Hpcal4 Rat clofibrate multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HPCAL4 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of HPCAL4 mRNA] CTD PMID:17585979 Hpcal4 Rat clofibrate decreases expression ISO Hpcal4 (Mus musculus) 6480464 Clofibrate results in decreased expression of HPCAL4 mRNA CTD PMID:17585979 Hpcal4 Rat clozapine affects expression EXP 6480464 Clozapine affects the expression of HPCAL4 mRNA CTD PMID:12437575 Hpcal4 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of HPCAL4 mRNA CTD PMID:20187946 Hpcal4 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of HPCAL4 mRNA CTD PMID:17898221 Hpcal4 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of HPCAL4 mRNA CTD PMID:26577399 Hpcal4 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of HPCAL4 mRNA CTD PMID:18636392 Hpcal4 Rat entinostat increases expression ISO HPCAL4 (Homo sapiens) 6480464 entinostat results in increased expression of HPCAL4 mRNA CTD PMID:27188386 Hpcal4 Rat ethanol affects splicing ISO Hpcal4 (Mus musculus) 6480464 Ethanol affects the splicing of HPCAL4 mRNA CTD PMID:30319688 Hpcal4 Rat ethylparaben decreases expression ISO HPCAL4 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of HPCAL4 mRNA CTD PMID:37690743 Hpcal4 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of HPCAL4 mRNA CTD PMID:30307764 Hpcal4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HPCAL4 mRNA CTD PMID:33387578 Hpcal4 Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of HPCAL4 mRNA CTD PMID:12437575 Hpcal4 Rat ivermectin decreases expression ISO HPCAL4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HPCAL4 protein CTD PMID:32959892 Hpcal4 Rat lead(0) affects expression ISO HPCAL4 (Homo sapiens) 6480464 Lead affects the expression of HPCAL4 mRNA CTD PMID:28903495 Hpcal4 Rat lipopolysaccharide decreases expression ISO HPCAL4 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of HPCAL4 mRNA CTD PMID:35811015 Hpcal4 Rat lipopolysaccharide multiple interactions ISO HPCAL4 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Hpcal4 Rat maneb multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of HPCAL4 mRNA CTD PMID:36117858 Hpcal4 Rat methotrexate decreases expression ISO HPCAL4 (Homo sapiens) 6480464 Methotrexate results in decreased expression of HPCAL4 mRNA CTD PMID:24449571 Hpcal4 Rat N-nitrosodiethylamine increases expression ISO HPCAL4 (Homo sapiens) 6480464 Diethylnitrosamine results in increased expression of HPCAL4 mRNA CTD PMID:21527772 Hpcal4 Rat N-nitrosodiethylamine multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of HPCAL4 gene CTD PMID:23968726 Hpcal4 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of HPCAL4 mRNA CTD PMID:20360939 Hpcal4 Rat nicotine increases expression ISO HPCAL4 (Homo sapiens) 6480464 Nicotine results in increased expression of HPCAL4 mRNA CTD PMID:23825647 Hpcal4 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of HPCAL4 mRNA CTD PMID:18636392 Hpcal4 Rat ozone multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of HPCAL4 mRNA CTD PMID:34911549 Hpcal4 Rat paracetamol multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HPCAL4 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of HPCAL4 mRNA] CTD PMID:17585979 Hpcal4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of HPCAL4 mRNA CTD PMID:33387578 Hpcal4 Rat paracetamol increases expression ISO HPCAL4 (Homo sapiens) 6480464 Acetaminophen results in increased expression of HPCAL4 mRNA CTD PMID:26690555 Hpcal4 Rat paraquat multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of HPCAL4 mRNA CTD PMID:36117858 Hpcal4 Rat PCB138 multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Hpcal4 Rat pentanal increases expression ISO HPCAL4 (Homo sapiens) 6480464 pentanal results in increased expression of HPCAL4 mRNA CTD PMID:26079696 Hpcal4 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of HPCAL4 mRNA CTD PMID:20360939 Hpcal4 Rat piperonyl butoxide multiple interactions ISO Hpcal4 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of HPCAL4 gene CTD PMID:23968726 Hpcal4 Rat pirinixic acid increases expression ISO Hpcal4 (Mus musculus) 6480464 pirinixic acid results in increased expression of HPCAL4 mRNA CTD PMID:20813756 Hpcal4 Rat propanal increases expression ISO HPCAL4 (Homo sapiens) 6480464 propionaldehyde results in increased expression of HPCAL4 mRNA CTD PMID:26079696 Hpcal4 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO HPCAL4 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Hpcal4 Rat sotorasib multiple interactions ISO HPCAL4 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of HPCAL4 mRNA CTD PMID:36139627 Hpcal4 Rat testosterone undecanoate decreases expression ISO HPCAL4 (Homo sapiens) 6480464 testosterone undecanoate results in decreased expression of HPCAL4 mRNA CTD PMID:19074003 Hpcal4 Rat titanium dioxide increases methylation ISO Hpcal4 (Mus musculus) 6480464 titanium dioxide results in increased methylation of HPCAL4 gene CTD PMID:35295148 Hpcal4 Rat trametinib multiple interactions ISO HPCAL4 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of HPCAL4 mRNA CTD PMID:36139627 Hpcal4 Rat triclosan increases expression ISO HPCAL4 (Homo sapiens) 6480464 Triclosan results in increased expression of HPCAL4 mRNA CTD PMID:30510588 Hpcal4 Rat triphenyl phosphate affects expression ISO HPCAL4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HPCAL4 mRNA CTD PMID:37042841 Hpcal4 Rat triptonide increases expression ISO Hpcal4 (Mus musculus) 6480464 triptonide results in increased expression of HPCAL4 mRNA CTD PMID:33045310 Hpcal4 Rat valproic acid increases expression ISO HPCAL4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HPCAL4 mRNA CTD PMID:23179753 and PMID:28001369 Hpcal4 Rat valproic acid affects expression ISO HPCAL4 (Homo sapiens) 6480464 Valproic Acid affects the expression of HPCAL4 mRNA CTD PMID:25979313 Hpcal4 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of HPCAL4 mRNA CTD PMID:19015723 Hpcal4 Rat zoledronic acid decreases expression ISO HPCAL4 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of HPCAL4 mRNA CTD PMID:24714768
(S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) CGP 52608 (ISO) chloroprene (ISO) clofibrate (ISO) clozapine (EXP) cocaine (EXP) Cuprizon (EXP) dichlorine (EXP) entinostat (ISO) ethanol (ISO) ethylparaben (ISO) fenvalerate (EXP) gentamycin (EXP) haloperidol (EXP) ivermectin (ISO) lead(0) (ISO) lipopolysaccharide (ISO) maneb (ISO) methotrexate (ISO) N-nitrosodiethylamine (EXP,ISO) nicotine (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (ISO) pentanal (ISO) phenethyl caffeate (EXP) piperonyl butoxide (ISO) pirinixic acid (ISO) propanal (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sotorasib (ISO) testosterone undecanoate (ISO) titanium dioxide (ISO) trametinib (ISO) triclosan (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) zoledronic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Molecular cloning of two additional members of the neural visinin-like Ca(2+)-binding protein gene family.
Kajimoto Y, etal., J Neurochem 1993 Sep;61(3):1091-6.
3.
Molecular cloning of hippocalcin, a novel calcium-binding protein of the recoverin family exclusively expressed in hippocampus.
Kobayashi M, etal., Biochem Biophys Res Commun 1992 Nov 30;189(1):511-7.
4.
cDNA cloning of a neural visinin-like Ca(2+)-binding protein.
Kuno T, etal., Biochem Biophys Res Commun 1992 May 15;184(3):1219-25.
5.
Modulation of CaV2.1 channels by the neuronal calcium-binding protein visinin-like protein-2.
Lautermilch NJ, etal., J Neurosci. 2005 Jul 27;25(30):7062-70.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Full sequence of neurocalcin, a novel calcium-binding protein abundant in central nervous system.
Okazaki K, etal., Biochem Biophys Res Commun 1992 May 29;185(1):147-53.
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Hpcal4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 140,739,577 - 140,751,529 (+) NCBI GRCr8 mRatBN7.2 5 135,454,477 - 135,466,417 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 135,454,540 - 135,466,416 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 138,161,114 - 138,168,988 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 139,931,081 - 139,938,951 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 139,938,218 - 139,946,092 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 140,870,127 - 140,882,242 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 140,870,140 - 140,882,244 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 144,660,294 - 144,672,321 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 142,490,462 - 142,498,359 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 142,495,687 - 142,503,585 (+) NCBI Celera 5 133,994,080 - 134,001,954 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
HPCAL4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 39,678,648 - 39,691,433 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 39,678,648 - 39,691,485 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 40,144,320 - 40,157,105 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 39,917,232 - 39,929,676 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 39,813,738 - 39,826,182 NCBI Celera 1 38,426,386 - 38,438,833 (-) NCBI Celera Cytogenetic Map 1 p34.2 NCBI HuRef 1 38,263,336 - 38,275,727 (-) NCBI HuRef CHM1_1 1 40,260,028 - 40,272,527 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 39,548,023 - 39,560,837 (-) NCBI T2T-CHM13v2.0
Hpcal4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 123,077,297 - 123,088,492 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 123,077,020 - 123,088,494 (+) Ensembl GRCm39 Ensembl GRCm38 4 123,183,504 - 123,194,699 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 123,183,227 - 123,194,701 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 122,860,747 - 122,871,942 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 122,685,807 - 122,697,002 (+) NCBI MGSCv36 mm8 Celera 4 121,515,883 - 121,527,080 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 57.4 NCBI
Hpcal4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 17,193,242 - 17,205,603 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 17,193,505 - 17,205,174 (-) NCBI ChiLan1.0 ChiLan1.0
HPCAL4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 187,130,106 - 187,143,251 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 186,267,798 - 186,280,942 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 38,969,006 - 38,982,080 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 40,295,463 - 40,308,469 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 40,295,463 - 40,308,469 (-) Ensembl panpan1.1 panPan2
HPCAL4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 3,196,653 - 3,205,191 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 3,194,653 - 3,201,425 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 3,452,643 - 3,463,915 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 3,314,002 - 3,325,291 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 3,313,655 - 3,325,285 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 3,190,163 - 3,201,450 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 3,251,220 - 3,262,502 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 3,266,783 - 3,278,071 (+) NCBI UU_Cfam_GSD_1.0
Hpcal4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 55,736,757 - 55,743,458 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 21,561,518 - 21,568,291 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 21,561,544 - 21,568,230 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HPCAL4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 95,502,684 - 95,515,871 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 95,502,679 - 95,515,892 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 88,590,972 - 88,604,172 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HPCAL4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 93,287,035 - 93,298,310 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 93,283,894 - 93,297,093 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 23,626,844 - 23,639,378 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hpcal4
.
Predicted Target Of
Count of predictions: 482 Count of miRNA genes: 246 Interacting mature miRNAs: 322 Transcripts: ENSRNOT00000074347 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 7411722 Strs6 Sensitivity to stroke QTL 6 3.9 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 5 134972980 138113556 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH130873
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 135,466,053 - 135,466,244 (+) MAPPER mRatBN7.2 Rnor_6.0 5 140,881,879 - 140,882,069 NCBI Rnor6.0 Rnor_5.0 5 144,671,958 - 144,672,148 UniSTS Rnor5.0 RGSC_v3.4 5 142,501,720 - 142,501,910 UniSTS RGSC3.4 Celera 5 134,005,315 - 134,005,505 UniSTS Cytogenetic Map 5 q36 UniSTS
AI846570
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 135,466,252 - 135,466,391 (+) MAPPER mRatBN7.2 Rnor_6.0 5 140,882,078 - 140,882,216 NCBI Rnor6.0 Rnor_5.0 5 144,672,157 - 144,672,295 UniSTS Rnor5.0 RGSC_v3.4 5 142,501,919 - 142,502,057 UniSTS RGSC3.4 Celera 5 134,005,514 - 134,005,652 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
6
26
111
52
53
24
17
24
6
138
58
93
41
58
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074347 ⟹ ENSRNOP00000066655
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 135,454,540 - 135,466,416 (+) Ensembl Rnor_6.0 Ensembl 5 140,870,140 - 140,882,244 (+) Ensembl
RefSeq Acc Id:
NM_017357 ⟹ NP_059053
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,739,908 - 140,747,805 (+) NCBI mRatBN7.2 5 135,454,796 - 135,462,693 (+) NCBI Rnor_6.0 5 140,870,551 - 140,878,518 (+) NCBI Rnor_5.0 5 144,660,294 - 144,672,321 (+) NCBI RGSC_v3.4 5 142,490,462 - 142,498,359 (+) RGD Celera 5 133,994,080 - 134,001,954 (+) RGD
Sequence:
TTTCACTTCAAGCCGAGTCCCCAGTTCAAGAAGGAGGTACGGCCGCCTCCTTACCCCCATCTCAGGCCCACCATGGGGAAGAACAATAGCAAGCTGGCCCCTGAGGAGCTGGAAGATCTGGTCCAGAA
hide sequence
RefSeq Acc Id:
XM_006238829 ⟹ XP_006238891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,739,577 - 140,751,529 (+) NCBI mRatBN7.2 5 135,454,477 - 135,466,417 (+) NCBI Rnor_6.0 5 140,870,127 - 140,882,242 (+) NCBI Rnor_5.0 5 144,660,294 - 144,672,321 (+) NCBI
Sequence:
ACTCACAGGCCACCCCATCCCCACCTGAAACCCCGCCTGTCACTCGGTGCCAGCTGAACCAATC
hide sequence
RefSeq Acc Id:
NP_059053 ⟸ NM_017357
- UniProtKB:
P35332 (UniProtKB/Swiss-Prot), A6IS20 (UniProtKB/TrEMBL)
- Sequence:
MGKNNSKLAPEELEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAI
hide sequence
RefSeq Acc Id:
XP_006238891 ⟸ XM_006238829
- Peptide Label:
isoform X1
- Sequence:
MGKNNSKLAPEELEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKF
hide sequence
Ensembl Acc Id:
ENSRNOP00000066655 ⟸ ENSRNOT00000074347
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-08
Hpcal4
hippocalcin-like 4
Nvjp2
neural visinin-like Ca2+-binding protein type 2
Symbol and Name updated
1299863 APPROVED
