Symbol:
Havcr1
Name:
hepatitis A virus cellular receptor 1
RGD ID:
708425
Description:
Predicted to enable phosphatidylserine binding activity and virus receptor activity. Involved in several processes, including phagocytosis, engulfment; response to mycotoxin; and response to testosterone. Located in several cellular components, including apical plasma membrane; cell surface; and phagocytic vesicle. Biomarker of colitis; hypertension; kidney failure (multiple); and proteinuria (multiple). Human ortholog(s) of this gene implicated in atopic dermatitis. Orthologous to human HAVCR1 (hepatitis A virus cellular receptor 1); INTERACTS WITH (R)-lipoic acid; 1-naphthyl isothiocyanate; 11-deoxycorticosterone.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
HAVcr-1; hepatitis A virus cellular receptor 1 homolog; kidney injury molecule 1; KIM-1; Kim1; t cell immunoglobulin and mucin domain-containing protein 1; TIMD-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 31,619,914 - 31,652,955 (+) NCBI GRCr8 mRatBN7.2 10 31,118,667 - 31,151,730 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 31,119,088 - 31,151,698 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 35,844,047 - 35,867,236 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 4,382,417 - 4,405,608 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 30,831,210 - 30,854,422 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 31,813,819 - 31,860,934 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 31,813,814 - 31,848,379 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 31,632,718 - 31,682,172 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 31,834,519 - 31,858,019 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 31,835,567 - 31,859,066 (+) NCBI Celera 10 30,573,361 - 30,596,533 (+) NCBI Celera Cytogenetic Map 10 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Havcr1 Rat (R)-lipoic acid multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [Thioctic Acid binds to Gold] which results in increased expression of HAVCR1 protein CTD PMID:28433809 Havcr1 Rat (R)-lipoic acid multiple interactions EXP 6480464 Thioctic Acid inhibits the reaction [[colistinmethanesulfonic acid results in increased abundance of Colistin] which results in increased expression of HAVCR1 mRNA] and Thioctic Acid inhibits the reaction [[colistinmethanesulfonic acid results in increased abundance of Colistin] which results in increased expression of HAVCR1 protein] CTD PMID:33111558 Havcr1 Rat (S)-naringenin multiple interactions ISO Havcr1 (Mus musculus) 6480464 naringenin inhibits the reaction [Carbon Tetrachloride results in increased expression of HAVCR1 protein] CTD PMID:23845967 Havcr1 Rat (S)-nicotine increases expression ISO Havcr1 (Mus musculus) 6480464 Nicotine results in increased expression of HAVCR1 protein CTD PMID:21511693 Havcr1 Rat 1-aminobenzotriazole multiple interactions ISO Havcr1 (Mus musculus) 6480464 [1-aminobenzotriazole co-treated with ochratoxin A] results in increased expression of HAVCR1 protein CTD PMID:36227364 Havcr1 Rat 1-naphthyl isothiocyanate affects expression EXP 6480464 1-Naphthylisothiocyanate affects the expression of HAVCR1 mRNA CTD PMID:18289764 Havcr1 Rat 11-deoxycorticosterone multiple interactions EXP 6480464 [Desoxycorticosterone co-treated with Sodium Chloride and Dietary] results in increased expression of HAVCR1 mRNA CTD PMID:21135038 Havcr1 Rat 17beta-estradiol decreases expression ISO Havcr1 (Mus musculus) 6480464 Estradiol results in decreased expression of HAVCR1 mRNA CTD PMID:39298647 Havcr1 Rat 17beta-estradiol 3-benzoate decreases expression EXP 6480464 estradiol 3-benzoate results in decreased expression of HAVCR1 mRNA CTD PMID:32741896 Havcr1 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of HAVCR1 mRNA CTD PMID:23307618 Havcr1 Rat 2,4,6-trinitrobenzenesulfonic acid increases secretion EXP 6480464 Trinitrobenzenesulfonic Acid results in increased secretion of HAVCR1 protein CTD PMID:23307618 Havcr1 Rat 3-chloropropane-1,2-diol increases expression ISO Havcr1 (Mus musculus) 6480464 alpha-Chlorohydrin analog results in increased expression of HAVCR1 mRNA and alpha-Chlorohydrin results in increased expression of HAVCR1 protein CTD PMID:29860048 and PMID:33187795 Havcr1 Rat 3-chloropropane-1,2-diol multiple interactions ISO Havcr1 (Mus musculus) 6480464 alpha-Chlorohydrin promotes the reaction [glycidol results in increased expression of HAVCR1 protein] and glycidol promotes the reaction [alpha-Chlorohydrin results in increased expression of HAVCR1 protein] CTD PMID:33187795 Havcr1 Rat 3-methyladenine multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [alisol A 24-acetate results in increased expression of HAVCR1 protein] and 3-methyladenine inhibits the reaction [alisol B 23-acetate results in increased expression of HAVCR1 protein] CTD PMID:28408883 Havcr1 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of HAVCR1 mRNA CTD PMID:18289764 Havcr1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Havcr1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of HAVCR1 mRNA CTD PMID:18648102 Havcr1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO HAVCR1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of HAVCR1 gene CTD PMID:31601247 Havcr1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HAVCR1 mRNA CTD PMID:36041667 Havcr1 Rat 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide multiple interactions ISO Havcr1 (Mus musculus) 6480464 6-chloro-2 more ... CTD PMID:21593185 and PMID:37436358 Havcr1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases expression EXP 6480464 Uric Acid results in increased expression of HAVCR1 protein CTD PMID:37815028 Havcr1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions EXP 6480464 IL17A protein affects the reaction [Uric Acid results in increased expression of HAVCR1 protein] CTD PMID:37815028 Havcr1 Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of HAVCR1 mRNA CTD PMID:28959563 Havcr1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of HAVCR1 protein CTD PMID:38348719 Havcr1 Rat acrylamide multiple interactions EXP 6480464 vinpocetine inhibits the reaction [Acrylamide results in increased expression of HAVCR1 protein] CTD PMID:38348719 Havcr1 Rat adefovir increases secretion EXP 6480464 adefovir results in increased secretion of HAVCR1 protein CTD PMID:27742868 Havcr1 Rat adenine increases expression ISO Havcr1 (Mus musculus) 6480464 Adenine results in increased expression of HAVCR1 protein CTD PMID:34619300 Havcr1 Rat aflatoxin B1 increases expression ISO HAVCR1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of HAVCR1 mRNA CTD PMID:22100608 Havcr1 Rat aflatoxin B1 increases methylation ISO HAVCR1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of HAVCR1 intron CTD PMID:30157460 Havcr1 Rat agomelatine multiple interactions EXP 6480464 agomelatine inhibits the reaction [Dietary Fats results in increased expression of HAVCR1 protein] CTD PMID:34081941 Havcr1 Rat aldehydo-D-glucose multiple interactions ISO Havcr1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of HAVCR1 mRNA CTD PMID:37567420 Havcr1 Rat allyl alcohol increases expression ISO HAVCR1 (Homo sapiens) 6480464 allyl alcohol results in increased expression of HAVCR1 mRNA CTD PMID:21907259 Havcr1 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of HAVCR1 mRNA CTD PMID:35163327 Havcr1 Rat amlodipine multiple interactions EXP 6480464 Amlodipine inhibits the reaction [Iohexol results in increased expression of HAVCR1 protein] CTD PMID:36207783 Havcr1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HAVCR1 mRNA CTD PMID:16483693 Havcr1 Rat amphotericin B methyl ester increases expression ISO Havcr1 (Mus musculus) 6480464 methylamphotericin B results in increased expression of HAVCR1 mRNA CTD PMID:22863853 Havcr1 Rat anethole multiple interactions EXP 6480464 anethole inhibits the reaction [Doxorubicin results in increased expression of HAVCR1 protein] CTD PMID:39029857 Havcr1 Rat anthocyanin multiple interactions EXP 6480464 Anthocyanins inhibits the reaction [Carbon Tetrachloride results in increased expression of HAVCR1 protein] CTD PMID:30825423 Havcr1 Rat anthracen-2-amine increases expression EXP 6480464 2-anthramine results in increased expression of HAVCR1 mRNA CTD PMID:31714650 Havcr1 Rat antimony(0) increases expression ISO HAVCR1 (Homo sapiens) 6480464 Antimony results in increased expression of HAVCR1 protein CTD PMID:38097005 Havcr1 Rat antimony(0) multiple interactions ISO Havcr1 (Mus musculus) 6480464 ferrostatin-1 inhibits the reaction [Antimony results in increased expression of HAVCR1 protein] CTD PMID:38097005 Havcr1 Rat antimony(0) multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Antimony results in increased expression of HAVCR1 protein] and MCOLN1 protein inhibits the reaction [Antimony results in increased expression of HAVCR1 protein] CTD PMID:38097005 Havcr1 Rat antimony(0) increases expression ISO Havcr1 (Mus musculus) 6480464 Antimony results in increased expression of HAVCR1 protein CTD PMID:38097005 Havcr1 Rat aristolochic acid A increases expression ISO Havcr1 (Mus musculus) 6480464 aristolochic acid I results in increased expression of HAVCR1 protein CTD PMID:23019274 and PMID:34677723 Havcr1 Rat aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of HAVCR1 protein CTD PMID:35690179 Havcr1 Rat aristolochic acid A multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [LRG1 protein results in increased susceptibility to aristolochic acid I] which results in increased expression of HAVCR1 protein and TGFBR1 mRNA promotes the reaction [[LRG1 protein results in increased susceptibility to aristolochic acid I] which results in increased expression of HAVCR1 protein] CTD PMID:34677723 Havcr1 Rat aristolochic acid A increases expression ISO HAVCR1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of HAVCR1 protein CTD PMID:34677723 Havcr1 Rat aristolochic acid A decreases expression ISO HAVCR1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of HAVCR1 mRNA and aristolochic acid I results in decreased expression of HAVCR1 protein CTD PMID:33212167 Havcr1 Rat arotinoid acid multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Havcr1 Rat arsane increases expression ISO HAVCR1 (Homo sapiens) 6480464 Arsenic results in increased expression of HAVCR1 mRNA CTD PMID:36861143 Havcr1 Rat arsenic atom increases expression ISO HAVCR1 (Homo sapiens) 6480464 Arsenic results in increased expression of HAVCR1 mRNA CTD PMID:36861143 Havcr1 Rat bacitracin increases expression EXP 6480464 Bacitracin results in increased expression of HAVCR1 mRNA CTD PMID:18289764 Havcr1 Rat benzo[a]pyrene affects methylation ISO HAVCR1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HAVCR1 promoter CTD PMID:27901495 Havcr1 Rat benzo[a]pyrene increases expression ISO HAVCR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HAVCR1 mRNA CTD PMID:32234424 Havcr1 Rat Bergenin multiple interactions EXP 6480464 bergenin inhibits the reaction [Cadmium results in increased expression of HAVCR1 protein] CTD PMID:37949422 Havcr1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Havcr1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of HAVCR1 protein CTD PMID:34670089 Havcr1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Havcr1 (Mus musculus) 6480464 Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of HAVCR1 protein] CTD PMID:34670089 Havcr1 Rat Bisibuthiamine multiple interactions EXP 6480464 sulbutiamine inhibits the reaction [Streptozocin results in increased expression of HAVCR1 protein] CTD PMID:37224990 Havcr1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HAVCR1 mRNA CTD PMID:25181051 Havcr1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HAVCR1 mRNA CTD PMID:34947998 Havcr1 Rat bisphenol A increases expression ISO Havcr1 (Mus musculus) 6480464 bisphenol A results in increased expression of HAVCR1 mRNA CTD PMID:34281243 Havcr1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HAVCR1 mRNA and [bisphenol A co-treated with Testosterone] results in decreased expression of HAVCR1 mRNA CTD PMID:26496021 and PMID:36041667 Havcr1 Rat bisphenol AF decreases expression ISO Havcr1 (Mus musculus) 6480464 bisphenol AF results in decreased expression of HAVCR1 mRNA CTD PMID:34850234 Havcr1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HAVCR1 mRNA CTD PMID:36041667 Havcr1 Rat bleomycin A2 increases expression ISO Havcr1 (Mus musculus) 6480464 Bleomycin results in increased expression of HAVCR1 protein CTD PMID:29175452 Havcr1 Rat boric acid multiple interactions EXP 6480464 [boric acid results in increased abundance of Boron] inhibits the reaction [Acetaminophen results in increased expression of HAVCR1 protein] CTD PMID:35020164 Havcr1 Rat boron atom multiple interactions EXP 6480464 [boric acid results in increased abundance of Boron] inhibits the reaction [Acetaminophen results in increased expression of HAVCR1 protein] CTD PMID:35020164 Havcr1 Rat butanal decreases expression ISO HAVCR1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of HAVCR1 mRNA CTD PMID:26079696 Havcr1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of HAVCR1 mRNA CTD PMID:19167457 Havcr1 Rat cadmium atom increases export EXP 6480464 Cadmium results in increased export of HAVCR1 protein CTD PMID:17687258 Havcr1 Rat cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of HAVCR1 protein more ... CTD PMID:24093454 more ... Havcr1 Rat cadmium atom increases expression ISO HAVCR1 (Homo sapiens) 6480464 Cadmium results in increased expression of HAVCR1 protein CTD PMID:21888673 Havcr1 Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of HAVCR1 more ... CTD PMID:17687258 more ... Havcr1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of HAVCR1 mRNA and Cadmium Chloride results in increased expression of HAVCR1 protein CTD PMID:19371613 and PMID:24200859 Havcr1 Rat cadmium dichloride increases export EXP 6480464 Cadmium Chloride results in increased export of HAVCR1 protein CTD PMID:29421648 Havcr1 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of HAVCR1 promoter CTD PMID:22457795 Havcr1 Rat cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of HAVCR1 protein more ... CTD PMID:24200859 more ... Havcr1 Rat canagliflozin increases expression EXP 6480464 Canagliflozin results in increased expression of HAVCR1 CTD PMID:25130857 Havcr1 Rat catalpol multiple interactions ISO Havcr1 (Mus musculus) 6480464 6-chloro-2 more ... CTD PMID:37436358 Havcr1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of HAVCR1 mRNA CTD PMID:18500788 and PMID:20305092 Havcr1 Rat CGP 52608 multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to HAVCR1 gene] CTD PMID:28238834 Havcr1 Rat CGS-21680 multiple interactions ISO Havcr1 (Mus musculus) 6480464 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine inhibits the reaction [[Phosphorus and Dietary co-treated with Cisplatin] results in increased expression of HAVCR1 protein] CTD PMID:39332792 Havcr1 Rat CHIR 99021 multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Havcr1 Rat chlordecone decreases expression ISO Havcr1 (Mus musculus) 6480464 Chlordecone results in decreased expression of HAVCR1 mRNA CTD PMID:33711761 Havcr1 Rat chloroform increases expression ISO HAVCR1 (Homo sapiens) 6480464 Chloroform results in increased expression of HAVCR1 mRNA CTD PMID:21907259 Havcr1 Rat cholesterol multiple interactions EXP 6480464 [cocoa butter co-treated with Sodium Cholate co-treated with Cholesterol] results in increased expression of HAVCR1 mRNA CTD PMID:26606054 Havcr1 Rat chromium atom increases expression EXP 6480464 Chromium results in increased expression of HAVCR1 mRNA and Chromium results in increased expression of HAVCR1 protein CTD PMID:17934191 Havcr1 Rat chromium(6+) increases expression ISO HAVCR1 (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of HAVCR1 protein CTD PMID:30236763 Havcr1 Rat chromium(6+) increases expression EXP 6480464 chromium hexavalent ion results in increased expression of HAVCR1 protein CTD PMID:30236763 Havcr1 Rat cidofovir anhydrous multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 Probenecid inhibits the reaction [Cidofovir results in increased secretion of HAVCR1 protein] and Tenofovir inhibits the reaction [Cidofovir results in increased secretion of HAVCR1 protein] CTD PMID:29738843 Havcr1 Rat cidofovir anhydrous increases secretion ISO HAVCR1 (Homo sapiens) 6480464 Cidofovir results in increased secretion of HAVCR1 protein CTD PMID:29738843 Havcr1 Rat cilnidipine multiple interactions EXP 6480464 cilnidipine inhibits the reaction [Iohexol results in increased expression of HAVCR1 protein] CTD PMID:36207783 Havcr1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of HAVCR1 mRNA and Cisplatin results in increased expression of HAVCR1 protein CTD PMID:15033597 more ... Havcr1 Rat cisplatin increases activity ISO Havcr1 (Mus musculus) 6480464 Cisplatin results in increased activity of HAVCR1 mRNA CTD PMID:20702592 Havcr1 Rat cisplatin increases expression ISO HAVCR1 (Homo sapiens) 6480464 Cisplatin results in increased expression of HAVCR1 mRNA and Cisplatin results in increased expression of HAVCR1 protein CTD PMID:23287709 and PMID:37863467 Havcr1 Rat cisplatin increases secretion EXP 6480464 Cisplatin results in increased secretion of HAVCR1 protein CTD PMID:20438795 more ... Havcr1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of HAVCR1 mRNA CTD PMID:22023808 Havcr1 Rat cisplatin affects activity ISO Havcr1 (Mus musculus) 6480464 Cisplatin affects the activity of HAVCR1 CTD PMID:21835770 Havcr1 Rat cisplatin multiple interactions ISO Havcr1 (Mus musculus) 6480464 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine inhibits the reaction [[Phosphorus more ... CTD PMID:21593185 more ... Havcr1 Rat cisplatin increases expression ISO Havcr1 (Mus musculus) 6480464 Cisplatin results in increased expression of HAVCR1 mRNA and Cisplatin results in increased expression of HAVCR1 protein CTD PMID:21593185 more ... Havcr1 Rat cisplatin multiple interactions EXP 6480464 7-hydroxycoumarin inhibits the reaction [Cisplatin results in increased expression of HAVCR1 protein] more ... CTD PMID:23603837 more ... Havcr1 Rat cobalt dichloride decreases expression ISO HAVCR1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of HAVCR1 mRNA CTD PMID:19376846 Havcr1 Rat colistin multiple interactions EXP 6480464 [colistinmethanesulfonic acid results in increased abundance of Colistin] which results in increased expression of HAVCR1 mRNA more ... CTD PMID:33111558 Havcr1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of HAVCR1 mRNA CTD PMID:22465980 Havcr1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of HAVCR1 mRNA CTD PMID:22465980 Havcr1 Rat copper(II) sulfate multiple interactions EXP 6480464 Curcumin analog inhibits the reaction [Copper Sulfate results in increased expression of HAVCR1 protein] more ... CTD PMID:30431687 Havcr1 Rat copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of HAVCR1 protein CTD PMID:30431687 Havcr1 Rat cortisol multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Havcr1 Rat curcumin multiple interactions EXP 6480464 Curcumin analog inhibits the reaction [Copper Sulfate results in increased expression of HAVCR1 protein] more ... CTD PMID:25119790 more ... Havcr1 Rat cyanocob(III)alamin multiple interactions ISO Havcr1 (Mus musculus) 6480464 [Vitamin B 6 co-treated with Vitamin B 12 co-treated with Folic Acid] inhibits the reaction [[Air Pollutants results in increased abundance of Particulate Matter] which results in increased expression of HAVCR1 protein] CTD PMID:37263574 Havcr1 Rat cyanocob(III)alamin multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [Vitamin B 6 co-treated with Vitamin B 12 co-treated with Folic Acid] inhibits the reaction [[Air Pollutants results in increased abundance of Particulate Matter] which results in increased expression of HAVCR1 protein] CTD PMID:37263574 Havcr1 Rat cyanuric acid multiple interactions EXP 6480464 [cyanuric acid co-treated with melamine] results in increased expression of HAVCR1 mRNA more ... CTD PMID:21784140 more ... Havcr1 Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of HAVCR1 protein CTD PMID:36198566 Havcr1 Rat cyclophosphamide multiple interactions EXP 6480464 herbacetin inhibits the reaction [Cyclophosphamide results in increased expression of HAVCR1 protein] CTD PMID:36198566 Havcr1 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of HAVCR1 mRNA CTD PMID:21865292 Havcr1 Rat cyclosporin A multiple interactions ISO Havcr1 (Mus musculus) 6480464 ethyl 6-(N-(2-chloro-4-fluorophenyl)sulfamoyl)cyclohex-1-ene-1-carboxylate inhibits the reaction [Cyclosporine results in increased expression of HAVCR1 mRNA] and TLR4 gene mutant form inhibits the reaction [Cyclosporine results in increased expression of HAVCR1 mRNA] CTD PMID:27585667 Havcr1 Rat cyclosporin A increases expression ISO Havcr1 (Mus musculus) 6480464 Cyclosporine results in increased expression of HAVCR1 mRNA CTD PMID:23958496 and PMID:27585667 Havcr1 Rat cyclosporin A affects expression EXP 6480464 Cyclosporine affects the expression of HAVCR1 mRNA and Cyclosporine affects the expression of HAVCR1 protein CTD PMID:24971338 Havcr1 Rat D-glucose multiple interactions ISO Havcr1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of HAVCR1 mRNA CTD PMID:37567420 Havcr1 Rat dapagliflozin multiple interactions EXP 6480464 dapagliflozin inhibits the reaction [[Streptozocin co-treated with Fructose] results in increased expression of HAVCR1 protein] more ... CTD PMID:30551545 Havcr1 Rat deferasirox increases expression EXP 6480464 deferasirox results in increased expression of HAVCR1 protein CTD PMID:21439361 Havcr1 Rat deferasirox increases expression ISO Havcr1 (Mus musculus) 6480464 deferasirox results in increased expression of HAVCR1 protein CTD PMID:21439361 Havcr1 Rat desferrioxamine B multiple interactions EXP 6480464 Deferoxamine inhibits the reaction [Cadmium results in increased expression of HAVCR1 protein] and Deferoxamine inhibits the reaction [Copper Sulfate results in increased expression of HAVCR1 protein] CTD PMID:30431687 and PMID:39025289 Havcr1 Rat Di-n-octyl phthalate multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [Phthalic Acids results in increased abundance of di-n-octyl phthalate metabolite] which results in increased secretion of HAVCR1 protein CTD PMID:33052911 Havcr1 Rat diclofenac increases expression ISO HAVCR1 (Homo sapiens) 6480464 Diclofenac results in increased expression of HAVCR1 mRNA CTD PMID:23506792 Havcr1 Rat diclofenac multiple interactions EXP 6480464 diacerein inhibits the reaction [Diclofenac results in increased secretion of HAVCR1 protein] CTD PMID:38582345 Havcr1 Rat diclofenac increases secretion EXP 6480464 Diclofenac results in increased secretion of HAVCR1 protein CTD PMID:38582345 Havcr1 Rat dimethyl fumarate multiple interactions ISO Havcr1 (Mus musculus) 6480464 Dimethyl Fumarate inhibits the reaction [sodium aescinate results in increased expression of HAVCR1] CTD PMID:38364601 Havcr1 Rat disodium selenite multiple interactions ISO Havcr1 (Mus musculus) 6480464 Sodium Selenite inhibits the reaction [sodium aescinate results in increased expression of HAVCR1] CTD PMID:38364601 Havcr1 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of HAVCR1 mRNA and Doxorubicin results in increased expression of HAVCR1 protein CTD PMID:19225054 more ... Havcr1 Rat doxorubicin increases secretion EXP 6480464 Doxorubicin results in increased secretion of HAVCR1 protein CTD PMID:28885000 Havcr1 Rat doxorubicin multiple interactions EXP 6480464 anethole inhibits the reaction [Doxorubicin results in increased expression of HAVCR1 protein] more ... CTD PMID:19225054 more ... Havcr1 Rat elemental boron multiple interactions EXP 6480464 [boric acid results in increased abundance of Boron] inhibits the reaction [Acetaminophen results in increased expression of HAVCR1 protein] CTD PMID:35020164 Havcr1 Rat erastin multiple interactions ISO Havcr1 (Mus musculus) 6480464 erastin inhibits the reaction [Quercetin inhibits the reaction [ochratoxin A results in increased expression of HAVCR1 mRNA]] CTD PMID:39053875 Havcr1 Rat erythrosin B multiple interactions EXP 6480464 [Tartrazine co-treated with Erythrosine] affects the expression of HAVCR1 mRNA CTD PMID:32981412 Havcr1 Rat ethanol multiple interactions ISO Havcr1 (Mus musculus) 6480464 [Ethanol co-treated with Carbon Tetrachloride] results in increased expression of HAVCR1 mRNA CTD PMID:28285099 Havcr1 Rat ethylene glycol increases expression ISO HAVCR1 (Homo sapiens) 6480464 Ethylene Glycol results in increased expression of HAVCR1 mRNA CTD PMID:21907259 Havcr1 Rat ethylene glycol multiple interactions EXP 6480464 caryophyllene inhibits the reaction [Ethylene Glycol results in increased expression of HAVCR1 mRNA] CTD PMID:34468068 Havcr1 Rat ethylene glycol increases expression EXP 6480464 Ethylene Glycol results in increased expression of HAVCR1 mRNA CTD PMID:21907259 and PMID:34468068 Havcr1 Rat ethylparaben decreases expression ISO HAVCR1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of HAVCR1 mRNA CTD PMID:37690743 Havcr1 Rat fenamic acid increases expression EXP 6480464 fenamic acid results in increased expression of HAVCR1 mRNA CTD PMID:23142791 Havcr1 Rat ferrostatin-1 multiple interactions ISO Havcr1 (Mus musculus) 6480464 ferrostatin-1 inhibits the reaction [Antimony results in increased expression of HAVCR1 protein] more ... CTD PMID:34785303 more ... Havcr1 Rat ferrostatin-1 multiple interactions EXP 6480464 ferrostatin-1 inhibits the reaction [Cadmium results in increased expression of HAVCR1 protein] CTD PMID:39025289 Havcr1 Rat folic acid decreases expression ISO Havcr1 (Mus musculus) 6480464 Folic Acid results in decreased expression of HAVCR1 mRNA CTD PMID:25629700 Havcr1 Rat folic acid multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [Vitamin B 6 co-treated with Vitamin B 12 co-treated with Folic Acid] inhibits the reaction [[Air Pollutants results in increased abundance of Particulate Matter] which results in increased expression of HAVCR1 protein] CTD PMID:37263574 Havcr1 Rat folic acid multiple interactions ISO Havcr1 (Mus musculus) 6480464 [Vitamin B 6 co-treated with Vitamin B 12 co-treated with Folic Acid] inhibits the reaction [[Air Pollutants results in increased abundance of Particulate Matter] which results in increased expression of HAVCR1 protein] more ... CTD PMID:23255615 more ... Havcr1 Rat folic acid increases expression ISO Havcr1 (Mus musculus) 6480464 Folic Acid results in increased expression of HAVCR1 mRNA and Folic Acid results in increased expression of HAVCR1 protein CTD PMID:23255615 more ... Havcr1 Rat formaldehyde increases expression ISO HAVCR1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of HAVCR1 mRNA CTD PMID:21907259 Havcr1 Rat formononetin multiple interactions EXP 6480464 formononetin inhibits the reaction [Cisplatin results in increased expression of HAVCR1 mRNA] CTD PMID:28414026 Havcr1 Rat fructose multiple interactions EXP 6480464 [Streptozocin co-treated with Fructose] results in increased expression of HAVCR1 protein more ... CTD PMID:30551545 Havcr1 Rat fructose multiple interactions ISO Havcr1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of HAVCR1 mRNA CTD PMID:37567420 Havcr1 Rat galangin multiple interactions EXP 6480464 galangin inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of HAVCR1 protein] CTD PMID:35384154 Havcr1 Rat gefitinib multiple interactions ISO Havcr1 (Mus musculus) 6480464 Gefitinib promotes the reaction [Folic Acid results in increased expression of HAVCR1 protein] CTD PMID:23255615 Havcr1 Rat gentamycin multiple interactions EXP 6480464 [Diatrizoate Meglumine co-treated with Gentamicins] results in increased expression of HAVCR1 protein more ... CTD PMID:19349640 more ... Havcr1 Rat gentamycin increases expression ISO HAVCR1 (Homo sapiens) 6480464 Gentamicins results in increased expression of HAVCR1 mRNA CTD PMID:29992668 Havcr1 Rat gentamycin affects expression EXP 6480464 Gentamicins affects the expression of HAVCR1 mRNA CTD PMID:20623750 Havcr1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HAVCR1 mRNA and Gentamicins results in increased expression of HAVCR1 protein CTD PMID:17636248 more ... Havcr1 Rat gentamycin increases secretion EXP 6480464 Gentamicins results in increased secretion of HAVCR1 protein CTD PMID:20816719 Havcr1 Rat geraniol multiple interactions EXP 6480464 geraniol inhibits the reaction [[ferric nitrilotriacetate co-treated with Diethylnitrosamine] results in increased expression of HAVCR1 mRNA] and geraniol inhibits the reaction [[ferric nitrilotriacetate co-treated with Diethylnitrosamine] results in increased expression of HAVCR1 protein] CTD PMID:21907755 Havcr1 Rat glucose multiple interactions ISO Havcr1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of HAVCR1 mRNA CTD PMID:37567420 Havcr1 Rat glycidol multiple interactions ISO Havcr1 (Mus musculus) 6480464 alpha-Chlorohydrin promotes the reaction [glycidol results in increased expression of HAVCR1 protein] and glycidol promotes the reaction [alpha-Chlorohydrin results in increased expression of HAVCR1 protein] CTD PMID:33187795 Havcr1 Rat glycidol increases expression ISO Havcr1 (Mus musculus) 6480464 glycidol results in increased expression of HAVCR1 mRNA and glycidol results in increased expression of HAVCR1 protein CTD PMID:33187795 Havcr1 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of HAVCR1 mRNA and Glyphosate results in increased expression of HAVCR1 protein CTD PMID:24361898 and PMID:37001608 Havcr1 Rat gold atom multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [Polyethylene Glycols binds to Gold] which results in increased expression of HAVCR1 protein more ... CTD PMID:28433809 Havcr1 Rat gold(0) multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [Polyethylene Glycols binds to Gold] which results in increased expression of HAVCR1 protein more ... CTD PMID:28433809 Havcr1 Rat herbacetin multiple interactions EXP 6480464 herbacetin inhibits the reaction [Cyclophosphamide results in increased expression of HAVCR1 protein] CTD PMID:36198566 Havcr1 Rat hesperidin multiple interactions EXP 6480464 Hesperidin inhibits the reaction [[Diethylnitrosamine co-treated with ferric nitrilotriacetate] results in increased secretion of HAVCR1 protein] more ... CTD PMID:22093918 and PMID:30098279 Havcr1 Rat Hexachloro-1,3-butadiene increases expression EXP 6480464 hexachlorobutadiene results in increased expression of HAVCR1 mRNA and hexachlorobutadiene results in increased expression of HAVCR1 protein CTD PMID:20305092 more ... Havcr1 Rat hydrogen chloride multiple interactions ISO Havcr1 (Mus musculus) 6480464 [NFE2L2 gene mutant form results in increased susceptibility to Hydrochloric Acid] which results in increased expression of HAVCR1 mRNA CTD PMID:29618784 Havcr1 Rat hydrogen peroxide affects expression ISO HAVCR1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of HAVCR1 mRNA CTD PMID:20044591 Havcr1 Rat hypoxanthine multiple interactions ISO Havcr1 (Mus musculus) 6480464 [Hypoxanthine co-treated with potassium oxonate] results in increased expression of HAVCR1 mRNA and salinomycin inhibits the reaction [[Hypoxanthine co-treated with potassium oxonate] results in increased expression of HAVCR1 mRNA] CTD PMID:39222901 Havcr1 Rat icariin multiple interactions EXP 6480464 icariin inhibits the reaction [Cadmium results in increased expression of HAVCR1 protein] CTD PMID:39197519 Havcr1 Rat icariin multiple interactions ISO Havcr1 (Mus musculus) 6480464 icariin inhibits the reaction [Folic Acid results in increased expression of HAVCR1 mRNA] and icariin inhibits the reaction [Folic Acid results in increased expression of HAVCR1 protein] CTD PMID:38272249 Havcr1 Rat icosanoid multiple interactions EXP 6480464 Eicosanoids analog inhibits the reaction [Cisplatin results in increased secretion of HAVCR1 protein] CTD PMID:23603837 Havcr1 Rat inositol multiple interactions ISO Havcr1 (Mus musculus) 6480464 Inositol inhibits the reaction [Cisplatin results in increased expression of HAVCR1 protein] CTD PMID:37863467 Havcr1 Rat iodixanol increases expression EXP 6480464 iodixanol results in increased expression of HAVCR1 mRNA CTD PMID:19104440 Havcr1 Rat iohexol multiple interactions EXP 6480464 Amlodipine inhibits the reaction [Iohexol results in increased expression of HAVCR1 protein] more ... CTD PMID:36207783 Havcr1 Rat iohexol increases expression EXP 6480464 Iohexol results in increased expression of HAVCR1 protein CTD PMID:36207783 Havcr1 Rat iron(III) nitrilotriacetate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with ferric nitrilotriacetate] results in increased secretion of HAVCR1 protein more ... CTD PMID:21907755 and PMID:30098279 Havcr1 Rat isocyanuric acid multiple interactions EXP 6480464 [cyanuric acid co-treated with melamine] results in increased expression of HAVCR1 mRNA more ... CTD PMID:21784140 more ... Havcr1 Rat isoliquiritigenin multiple interactions EXP 6480464 isoliquiritigenin inhibits the reaction [Cisplatin results in increased expression of HAVCR1 protein] CTD PMID:37561086 Havcr1 Rat isoniazide affects expression EXP 6480464 Isoniazid affects the expression of HAVCR1 mRNA CTD PMID:20623750 Havcr1 Rat ketamine multiple interactions ISO Havcr1 (Mus musculus) 6480464 [Ketamine co-treated with Xylazine] results in increased secretion of HAVCR1 protein CTD PMID:30538007 Havcr1 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of HAVCR1 mRNA CTD PMID:18289764 Havcr1 Rat L-ascorbic acid multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of HAVCR1 mRNA CTD PMID:34480604 Havcr1 Rat L-ascorbic acid 2-phosphate multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of HAVCR1 mRNA CTD PMID:34480604 Havcr1 Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of HAVCR1 protein CTD PMID:34350654 Havcr1 Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of HAVCR1 protein CTD PMID:34350654 Havcr1 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of HAVCR1 mRNA CTD PMID:35283115 Havcr1 Rat linoleic acid increases secretion ISO HAVCR1 (Homo sapiens) 6480464 Linoleic Acid results in increased secretion of HAVCR1 protein CTD PMID:31686351 Havcr1 Rat lipoic acid multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [Thioctic Acid binds to Gold] which results in increased expression of HAVCR1 protein CTD PMID:28433809 Havcr1 Rat lipoic acid multiple interactions EXP 6480464 Thioctic Acid inhibits the reaction [[colistinmethanesulfonic acid results in increased abundance of Colistin] which results in increased expression of HAVCR1 mRNA] and Thioctic Acid inhibits the reaction [[colistinmethanesulfonic acid results in increased abundance of Colistin] which results in increased expression of HAVCR1 protein] CTD PMID:33111558 Havcr1 Rat lipopolysaccharide increases expression ISO HAVCR1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of HAVCR1 protein CTD PMID:28433809 Havcr1 Rat lipopolysaccharide multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of HAVCR1 mRNA CTD PMID:35811015 Havcr1 Rat lipopolysaccharide multiple interactions ISO Havcr1 (Mus musculus) 6480464 6-chloro-2 more ... CTD PMID:35098763 and PMID:37436358 Havcr1 Rat lipopolysaccharide increases expression ISO Havcr1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of HAVCR1 protein CTD PMID:35098763 and PMID:37436358 Havcr1 Rat lisinopril dihydrate multiple interactions EXP 6480464 Lisinopril inhibits the reaction [Doxorubicin results in increased expression of HAVCR1 mRNA] and Lisinopril inhibits the reaction [Doxorubicin results in increased expression of HAVCR1 protein] CTD PMID:19225054 Havcr1 Rat losartan multiple interactions EXP 6480464 Losartan inhibits the reaction [Cadmium results in increased expression of HAVCR1] CTD PMID:24093454 Havcr1 Rat lycopene multiple interactions ISO Havcr1 (Mus musculus) 6480464 Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of HAVCR1 protein] CTD PMID:34670089 Havcr1 Rat madecassoside multiple interactions ISO Havcr1 (Mus musculus) 6480464 madecassoside inhibits the reaction [Cisplatin results in increased expression of HAVCR1 mRNA] CTD PMID:37087747 Havcr1 Rat maleic acid increases expression EXP 6480464 maleic acid results in increased expression of HAVCR1 protein CTD PMID:25119790 Havcr1 Rat maleic acid multiple interactions EXP 6480464 Curcumin inhibits the reaction [maleic acid results in increased expression of HAVCR1 protein] CTD PMID:25119790 Havcr1 Rat meglumine amidotrizoate multiple interactions EXP 6480464 [Diatrizoate Meglumine co-treated with Gentamicins] results in increased expression of HAVCR1 protein and CTF1 protein inhibits the reaction [[Diatrizoate Meglumine co-treated with Gentamicins] results in increased expression of HAVCR1 protein] CTD PMID:23335628 Havcr1 Rat melamine multiple interactions EXP 6480464 [cyanuric acid co-treated with melamine] results in increased expression of HAVCR1 mRNA more ... CTD PMID:21784140 more ... Havcr1 Rat melamine increases expression EXP 6480464 melamine results in increased expression of HAVCR1 CTD PMID:23052191 Havcr1 Rat melatonin multiple interactions ISO Havcr1 (Mus musculus) 6480464 Melatonin inhibits the reaction [sodium arsenite results in increased expression of HAVCR1 protein] CTD PMID:29763682 Havcr1 Rat menadione affects expression ISO HAVCR1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of HAVCR1 mRNA CTD PMID:20044591 Havcr1 Rat mercury atom increases expression EXP 6480464 Mercury results in increased expression of HAVCR1 mRNA and Mercury results in increased expression of HAVCR1 protein CTD PMID:17934191 and PMID:25145654 Havcr1 Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of HAVCR1 mRNA and Mercuric Chloride results in increased expression of HAVCR1 protein CTD PMID:18441258 more ... Havcr1 Rat mercury dichloride increases expression ISO Havcr1 (Mus musculus) 6480464 Mercuric Chloride results in increased expression of HAVCR1 mRNA CTD PMID:27720909 Havcr1 Rat mercury(0) increases expression EXP 6480464 Mercury results in increased expression of HAVCR1 mRNA and Mercury results in increased expression of HAVCR1 protein CTD PMID:17934191 and PMID:25145654 Havcr1 Rat metformin multiple interactions EXP 6480464 dapagliflozin promotes the reaction [Metformin inhibits the reaction [[Streptozocin co-treated with Fructose] results in increased expression of HAVCR1 protein]] more ... CTD PMID:30551545 Havcr1 Rat methamphetamine multiple interactions ISO Havcr1 (Mus musculus) 6480464 NFE2L2 protein affects the reaction [Methamphetamine results in increased expression of HAVCR1 protein] and sulforaphane inhibits the reaction [Methamphetamine results in increased expression of HAVCR1 protein] CTD PMID:37567421 Havcr1 Rat methamphetamine increases expression ISO Havcr1 (Mus musculus) 6480464 Methamphetamine results in increased expression of HAVCR1 protein CTD PMID:37567421 Havcr1 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of HAVCR1 mRNA CTD PMID:28536007 Havcr1 Rat methylmercury chloride increases expression ISO Havcr1 (Mus musculus) 6480464 methylmercuric chloride results in increased expression of HAVCR1 mRNA CTD PMID:27720909 Havcr1 Rat N-acetyl-L-cysteine multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Antimony results in increased expression of HAVCR1 protein] CTD PMID:38097005 Havcr1 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Acetaminophen results in increased expression of HAVCR1 protein] CTD PMID:35020164 Havcr1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with ferric nitrilotriacetate] results in increased secretion of HAVCR1 protein more ... CTD PMID:21907755 and PMID:30098279 Havcr1 Rat natamycin increases expression ISO Havcr1 (Mus musculus) 6480464 Natamycin results in increased expression of HAVCR1 mRNA CTD PMID:22863853 Havcr1 Rat nicorandil multiple interactions EXP 6480464 Nicorandil inhibits the reaction [Doxorubicin results in increased expression of HAVCR1 protein] CTD PMID:31376360 Havcr1 Rat nicotine increases expression ISO Havcr1 (Mus musculus) 6480464 Nicotine results in increased expression of HAVCR1 protein CTD PMID:21511693 Havcr1 Rat nifedipine multiple interactions EXP 6480464 Nifedipine inhibits the reaction [Iohexol results in increased expression of HAVCR1 protein] CTD PMID:36207783 Havcr1 Rat nitric oxide increases expression EXP 6480464 Nitric Oxide deficiency results in increased expression of HAVCR1 protein CTD PMID:19834340 Havcr1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of HAVCR1 mRNA CTD PMID:33484710 Havcr1 Rat nystatin increases expression ISO Havcr1 (Mus musculus) 6480464 Nystatin results in increased expression of HAVCR1 mRNA CTD PMID:22863853 Havcr1 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of HAVCR1 more ... CTD PMID:16251485 more ... Havcr1 Rat ochratoxin A increases expression ISO Havcr1 (Mus musculus) 6480464 ochratoxin A results in increased expression of HAVCR1 mRNA CTD PMID:39053875 Havcr1 Rat ochratoxin A multiple interactions ISO Havcr1 (Mus musculus) 6480464 [1-aminobenzotriazole co-treated with ochratoxin A] results in increased expression of HAVCR1 protein more ... CTD PMID:36227364 and PMID:39053875 Havcr1 Rat ochratoxin A multiple interactions EXP 6480464 HSPA9 protein affects the reaction [ochratoxin A results in increased expression of HAVCR1 protein] CTD PMID:31369848 Havcr1 Rat ochratoxin A multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 AHR protein affects the reaction [ochratoxin A results in increased expression of HAVCR1 mRNA] more ... CTD PMID:30291945 and PMID:31369848 Havcr1 Rat ochratoxin A increases expression ISO HAVCR1 (Homo sapiens) 6480464 ochratoxin A results in increased expression of HAVCR1 mRNA and ochratoxin A results in increased expression of HAVCR1 protein CTD PMID:30291945 and PMID:31369848 Havcr1 Rat ochratoxin A increases secretion EXP 6480464 ochratoxin A results in increased secretion of HAVCR1 mRNA CTD PMID:18308701 Havcr1 Rat oleic acid increases secretion ISO HAVCR1 (Homo sapiens) 6480464 Oleic Acid results in increased secretion of HAVCR1 protein CTD PMID:31686351 Havcr1 Rat Ondansetron multiple interactions ISO Havcr1 (Mus musculus) 6480464 Ondansetron promotes the reaction [Cisplatin results in increased expression of HAVCR1 mRNA] CTD PMID:24001450 Havcr1 Rat ozone decreases expression ISO Havcr1 (Mus musculus) 6480464 Ozone results in decreased expression of HAVCR1 mRNA CTD PMID:19555225 Havcr1 Rat ozone multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of HAVCR1 mRNA CTD PMID:35430440 Havcr1 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of HAVCR1 mRNA CTD PMID:36437433 Havcr1 Rat ozone multiple interactions EXP 6480464 Ozone inhibits the reaction [sodium arsenite results in increased expression of HAVCR1 mRNA] CTD PMID:36437433 Havcr1 Rat paracetamol multiple interactions EXP 6480464 [boric acid results in increased abundance of Boron] inhibits the reaction [Acetaminophen results in increased expression of HAVCR1 protein] more ... CTD PMID:22093918 and PMID:35020164 Havcr1 Rat paracetamol increases expression ISO Havcr1 (Mus musculus) 6480464 Acetaminophen results in increased expression of HAVCR1 mRNA CTD PMID:30099449 Havcr1 Rat paracetamol multiple interactions ISO Havcr1 (Mus musculus) 6480464 Rotenone inhibits the reaction [Acetaminophen results in increased expression of HAVCR1 mRNA] CTD PMID:30099449 Havcr1 Rat paracetamol decreases expression ISO HAVCR1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of HAVCR1 mRNA CTD PMID:26690555 Havcr1 Rat paracetamol affects expression ISO Havcr1 (Mus musculus) 6480464 Acetaminophen affects the expression of HAVCR1 mRNA CTD PMID:17562736 Havcr1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of HAVCR1 mRNA and Acetaminophen results in increased expression of HAVCR1 protein CTD PMID:22093918 and PMID:35020164 Havcr1 Rat paraquat multiple interactions ISO Havcr1 (Mus musculus) 6480464 [ABCB1A gene mutant form results in increased susceptibility to Paraquat] which results in increased expression of HAVCR1 mRNA more ... CTD PMID:21991918 and PMID:25015657 Havcr1 Rat paraquat increases expression ISO HAVCR1 (Homo sapiens) 6480464 Paraquat results in increased expression of HAVCR1 mRNA CTD PMID:34097952 Havcr1 Rat patulin increases expression EXP 6480464 Patulin results in increased expression of HAVCR1 protein CTD PMID:34896196 Havcr1 Rat Pentoxifylline multiple interactions EXP 6480464 Pentoxifylline inhibits the reaction [Cisplatin results in increased expression of and results in increased secretion of HAVCR1 protein] CTD PMID:32777238 Havcr1 Rat perfluorohexanesulfonic acid increases expression ISO HAVCR1 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in increased expression of HAVCR1 mRNA CTD PMID:25812627 Havcr1 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of HAVCR1 mRNA CTD PMID:28973641 Havcr1 Rat perfluorooctane-1-sulfonic acid increases expression ISO HAVCR1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of HAVCR1 mRNA CTD PMID:25812627 Havcr1 Rat perfluorooctanoic acid increases expression ISO HAVCR1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of HAVCR1 mRNA CTD PMID:25812627 Havcr1 Rat phenol increases expression ISO HAVCR1 (Homo sapiens) 6480464 Phenol results in increased expression of HAVCR1 mRNA CTD PMID:21907259 Havcr1 Rat phenylbutazone increases expression EXP 6480464 Phenylbutazone results in increased expression of HAVCR1 mRNA CTD PMID:23142791 Havcr1 Rat phenylmercury acetate increases secretion ISO HAVCR1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased secretion of HAVCR1 protein CTD PMID:31686351 Havcr1 Rat Phytolaccoside E decreases expression ISO HAVCR1 (Homo sapiens) 6480464 esculentoside A results in decreased expression of HAVCR1 protein CTD PMID:36460195 Havcr1 Rat Phytolaccoside E increases expression ISO Havcr1 (Mus musculus) 6480464 esculentoside A results in increased expression of HAVCR1 protein CTD PMID:36460195 Havcr1 Rat pinostrobin multiple interactions EXP 6480464 pinostrobin inhibits the reaction [Cadmium results in increased expression of HAVCR1 protein] CTD PMID:37342552 Havcr1 Rat pirinixic acid decreases expression ISO Havcr1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of HAVCR1 mRNA CTD PMID:23811191 Havcr1 Rat polymyxin B2 increases secretion ISO HAVCR1 (Homo sapiens) 6480464 Polymyxin B results in increased secretion of HAVCR1 protein CTD PMID:32905824 Havcr1 Rat Potassium 2,6-dihydroxytriazinecarboxylate multiple interactions ISO Havcr1 (Mus musculus) 6480464 [Hypoxanthine co-treated with potassium oxonate] results in increased expression of HAVCR1 mRNA and salinomycin inhibits the reaction [[Hypoxanthine co-treated with potassium oxonate] results in increased expression of HAVCR1 mRNA] CTD PMID:39222901 Havcr1 Rat potassium bromate increases expression EXP 6480464 potassium bromate results in increased expression of HAVCR1 mRNA and potassium bromate results in increased expression of HAVCR1 protein CTD PMID:23588252 and PMID:23811332 Havcr1 Rat potassium dichromate increases expression EXP 6480464 Potassium Dichromate results in increased expression of HAVCR1 mRNA and Potassium Dichromate results in increased expression of HAVCR1 protein CTD PMID:18441258 and PMID:20305092 Havcr1 Rat probenecid multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 Probenecid inhibits the reaction [cidofovir results in increased secretion of HAVCR1 protein] CTD PMID:29738843 Havcr1 Rat quercetin multiple interactions ISO Havcr1 (Mus musculus) 6480464 erastin inhibits the reaction [Quercetin inhibits the reaction [ochratoxin A results in increased expression of HAVCR1 mRNA]] and Quercetin inhibits the reaction [ochratoxin A results in increased expression of HAVCR1 mRNA] CTD PMID:39053875 Havcr1 Rat resveratrol multiple interactions ISO Havcr1 (Mus musculus) 6480464 6-chloro-2 more ... CTD PMID:21593185 Havcr1 Rat rotenone multiple interactions ISO Havcr1 (Mus musculus) 6480464 Rotenone inhibits the reaction [Acetaminophen results in increased expression of HAVCR1 mRNA] CTD PMID:30099449 Havcr1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of HAVCR1 mRNA CTD PMID:35811015 Havcr1 Rat Salinomycin multiple interactions ISO Havcr1 (Mus musculus) 6480464 salinomycin inhibits the reaction [[Hypoxanthine co-treated with potassium oxonate] results in increased expression of HAVCR1 mRNA] CTD PMID:39222901 Havcr1 Rat salubrinal multiple interactions ISO Havcr1 (Mus musculus) 6480464 salubrinal promotes the reaction [Cisplatin results in increased expression of HAVCR1 mRNA] CTD PMID:21616140 Havcr1 Rat SB 431542 multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with EGF protein co-treated with FGF2 protein] results in increased expression of HAVCR1 mRNA CTD PMID:34480604 Havcr1 Rat sirolimus increases expression EXP 6480464 Sirolimus results in increased expression of HAVCR1 mRNA CTD PMID:21865292 Havcr1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of HAVCR1 mRNA and sodium arsenite results in increased expression of HAVCR1 protein CTD PMID:26008221 and PMID:36437433 Havcr1 Rat sodium arsenite increases expression ISO HAVCR1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HAVCR1 mRNA CTD PMID:35954277 Havcr1 Rat sodium arsenite decreases expression ISO Havcr1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of HAVCR1 mRNA CTD PMID:37682722 Havcr1 Rat sodium arsenite multiple interactions ISO Havcr1 (Mus musculus) 6480464 Melatonin inhibits the reaction [sodium arsenite results in increased expression of HAVCR1 protein] CTD PMID:29763682 Havcr1 Rat sodium arsenite increases expression ISO Havcr1 (Mus musculus) 6480464 sodium arsenite results in increased expression of HAVCR1 protein CTD PMID:29763682 Havcr1 Rat sodium arsenite multiple interactions EXP 6480464 Ozone inhibits the reaction [sodium arsenite results in increased expression of HAVCR1 mRNA] CTD PMID:36437433 Havcr1 Rat sodium cholate multiple interactions EXP 6480464 [cocoa butter co-treated with Sodium Cholate co-treated with Cholesterol] results in increased expression of HAVCR1 mRNA CTD PMID:26606054 Havcr1 Rat sodium fluoride increases expression EXP 6480464 Sodium Fluoride results in increased expression of HAVCR1 mRNA and Sodium Fluoride results in increased expression of HAVCR1 protein CTD PMID:23933529 Havcr1 Rat sodium fluoride multiple interactions EXP 6480464 Sodium Fluoride inhibits the reaction [Gentamicins results in increased expression of HAVCR1 mRNA] and Sodium Fluoride inhibits the reaction [Gentamicins results in increased expression of HAVCR1 protein] CTD PMID:26779593 Havcr1 Rat streptozocin decreases expression ISO Havcr1 (Mus musculus) 6480464 Streptozocin results in decreased expression of HAVCR1 mRNA CTD PMID:19516248 Havcr1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of HAVCR1 protein CTD PMID:37224990 Havcr1 Rat streptozocin multiple interactions EXP 6480464 [Streptozocin co-treated with Fructose] results in increased expression of HAVCR1 protein more ... CTD PMID:30551545 and PMID:37224990 Havcr1 Rat sulforaphane multiple interactions ISO Havcr1 (Mus musculus) 6480464 sulforaphane inhibits the reaction [Methamphetamine results in increased expression of HAVCR1 protein] CTD PMID:37567421 Havcr1 Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of HAVCR1 mRNA CTD PMID:21865292 Havcr1 Rat tannic acid multiple interactions EXP 6480464 Tannic Acid inhibits the reaction [Doxorubicin results in increased expression of HAVCR1 mRNA] CTD PMID:35987278 Havcr1 Rat tartrazine multiple interactions EXP 6480464 [Tartrazine co-treated with Erythrosine] affects the expression of HAVCR1 mRNA CTD PMID:32981412 Havcr1 Rat tenofovir disoproxil fumarate increases secretion ISO HAVCR1 (Homo sapiens) 6480464 Tenofovir results in increased secretion of HAVCR1 protein CTD PMID:29738843 Havcr1 Rat tenofovir disoproxil fumarate multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 Tenofovir inhibits the reaction [cidofovir results in increased secretion of HAVCR1 protein] CTD PMID:29738843 Havcr1 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of HAVCR1 mRNA CTD PMID:26496021 Havcr1 Rat testosterone increases expression ISO Havcr1 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of HAVCR1 mRNA CTD PMID:33848595 Havcr1 Rat testosterone multiple interactions ISO Havcr1 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Havcr1 Rat tetrachloroethene increases expression ISO Havcr1 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of HAVCR1 mRNA and Tetrachloroethylene results in increased expression of HAVCR1 protein CTD PMID:28973375 and PMID:31246107 Havcr1 Rat tetrachloromethane increases expression ISO Havcr1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HAVCR1 protein CTD PMID:23845967 Havcr1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of HAVCR1 protein CTD PMID:30825423 Havcr1 Rat tetrachloromethane multiple interactions EXP 6480464 Anthocyanins inhibits the reaction [Carbon Tetrachloride results in increased expression of HAVCR1 protein] CTD PMID:30825423 Havcr1 Rat tetrachloromethane multiple interactions ISO Havcr1 (Mus musculus) 6480464 [Ethanol co-treated with Carbon Tetrachloride] results in increased expression of HAVCR1 mRNA and naringenin inhibits the reaction [Carbon Tetrachloride results in increased expression of HAVCR1 protein] CTD PMID:23845967 and PMID:28285099 Havcr1 Rat tetramethylpyrazine multiple interactions EXP 6480464 tetramethylpyrazine inhibits the reaction [Cadmium Chloride results in increased expression of HAVCR1 protein] CTD PMID:24200859 Havcr1 Rat thallium multiple interactions EXP 6480464 [thallium sulfate results in increased abundance of Thallium] which results in increased expression of HAVCR1 mRNA CTD PMID:39361050 Havcr1 Rat thallium sulfate multiple interactions EXP 6480464 [thallium sulfate results in increased abundance of Thallium] which results in increased expression of HAVCR1 mRNA CTD PMID:39361050 Havcr1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of HAVCR1 mRNA CTD PMID:23142791 more ... Havcr1 Rat titanium dioxide decreases expression ISO Havcr1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of HAVCR1 mRNA CTD PMID:35295148 Havcr1 Rat trans-anethole multiple interactions EXP 6480464 anethole inhibits the reaction [Doxorubicin results in increased expression of HAVCR1 protein] CTD PMID:39029857 Havcr1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of HAVCR1 protein CTD PMID:24923549 Havcr1 Rat umbelliferone multiple interactions EXP 6480464 7-hydroxycoumarin inhibits the reaction [Cisplatin results in increased expression of HAVCR1 protein] CTD PMID:33522649 Havcr1 Rat urethane decreases expression ISO HAVCR1 (Homo sapiens) 6480464 Urethane results in decreased expression of HAVCR1 mRNA CTD PMID:28818685 Havcr1 Rat vancomycin decreases expression ISO Havcr1 (Mus musculus) 6480464 Vancomycin results in decreased expression of HAVCR1 mRNA CTD PMID:18930951 Havcr1 Rat vancomycin multiple interactions EXP 6480464 JBP 485 inhibits the reaction [Vancomycin results in increased expression of HAVCR1 mRNA] CTD PMID:29964132 Havcr1 Rat vancomycin increases expression EXP 6480464 Vancomycin results in increased expression of HAVCR1 mRNA CTD PMID:18289764 and PMID:29964132 Havcr1 Rat vildagliptin multiple interactions EXP 6480464 Vildagliptin inhibits the reaction [Dietary Fats results in increased expression of HAVCR1 protein] CTD PMID:34081941 Havcr1 Rat Vinpocetine multiple interactions EXP 6480464 vinpocetine inhibits the reaction [Acrylamide results in increased expression of HAVCR1 protein] CTD PMID:38348719 Havcr1 Rat XAV939 multiple interactions ISO HAVCR1 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of HAVCR1 mRNA and [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of HAVCR1 mRNA CTD PMID:34480604 Havcr1 Rat xylazine multiple interactions ISO Havcr1 (Mus musculus) 6480464 [Ketamine co-treated with Xylazine] results in increased secretion of HAVCR1 protein CTD PMID:30538007 Havcr1 Rat zinc atom decreases expression ISO HAVCR1 (Homo sapiens) 6480464 Zinc results in decreased expression of HAVCR1 mRNA CTD PMID:15984569 Havcr1 Rat zinc protoporphyrin multiple interactions EXP 6480464 zinc protoporphyrin inhibits the reaction [Cadmium results in increased expression of HAVCR1 protein] CTD PMID:39025289 Havcr1 Rat zinc(0) decreases expression ISO HAVCR1 (Homo sapiens) 6480464 Zinc results in decreased expression of HAVCR1 mRNA CTD PMID:15984569 Havcr1 Rat zoledronic acid increases expression ISO HAVCR1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of HAVCR1 mRNA CTD PMID:28871336 Havcr1 Rat zoledronic acid increases expression ISO Havcr1 (Mus musculus) 6480464 zoledronic acid results in increased expression of HAVCR1 mRNA CTD PMID:28871336
(R)-lipoic acid (EXP,ISO) (S)-naringenin (ISO) (S)-nicotine (ISO) 1-aminobenzotriazole (ISO) 1-naphthyl isothiocyanate (EXP) 11-deoxycorticosterone (EXP) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (EXP) 2,4,6-trinitrobenzenesulfonic acid (EXP) 3-chloropropane-1,2-diol (ISO) 3-methyladenine (ISO) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (ISO) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (EXP) acrylamide (EXP) adefovir (EXP) adenine (ISO) aflatoxin B1 (ISO) agomelatine (EXP) aldehydo-D-glucose (ISO) allyl alcohol (ISO) alpha-Zearalanol (EXP) amlodipine (EXP) ammonium chloride (EXP) amphotericin B methyl ester (ISO) anethole (EXP) anthocyanin (EXP) anthracen-2-amine (EXP) antimony(0) (ISO) aristolochic acid A (EXP,ISO) arotinoid acid (ISO) arsane (ISO) arsenic atom (ISO) bacitracin (EXP) benzo[a]pyrene (ISO) Bergenin (EXP) bis(2-ethylhexyl) phthalate (ISO) Bisibuthiamine (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP) bleomycin A2 (ISO) boric acid (EXP) boron atom (EXP) butanal (ISO) C60 fullerene (EXP) cadmium atom (EXP,ISO) cadmium dichloride (EXP) canagliflozin (EXP) catalpol (ISO) cefaloridine (EXP) CGP 52608 (ISO) CGS-21680 (ISO) CHIR 99021 (ISO) chlordecone (ISO) chloroform (ISO) cholesterol (EXP) chromium atom (EXP) chromium(6+) (EXP,ISO) cidofovir anhydrous (ISO) cilnidipine (EXP) cisplatin (EXP,ISO) cobalt dichloride (ISO) colistin (EXP) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (EXP) cortisol (ISO) curcumin (EXP) cyanocob(III)alamin (ISO) cyanuric acid (EXP) cyclophosphamide (EXP) cyclosporin A (EXP,ISO) D-glucose (ISO) dapagliflozin (EXP) deferasirox (EXP,ISO) desferrioxamine B (EXP) Di-n-octyl phthalate (ISO) diclofenac (EXP,ISO) dimethyl fumarate (ISO) disodium selenite (ISO) doxorubicin (EXP) elemental boron (EXP) erastin (ISO) erythrosin B (EXP) ethanol (ISO) ethylene glycol (EXP,ISO) ethylparaben (ISO) fenamic acid (EXP) ferrostatin-1 (EXP,ISO) folic acid (ISO) formaldehyde (ISO) formononetin (EXP) fructose (EXP,ISO) galangin (EXP) gefitinib (ISO) gentamycin (EXP,ISO) geraniol (EXP) glucose (ISO) glycidol (ISO) glyphosate (EXP) gold atom (ISO) gold(0) (ISO) herbacetin (EXP) hesperidin (EXP) Hexachloro-1,3-butadiene (EXP) hydrogen chloride (ISO) hydrogen peroxide (ISO) hypoxanthine (ISO) icariin (EXP,ISO) icosanoid (EXP) inositol (ISO) iodixanol (EXP) iohexol (EXP) iron(III) nitrilotriacetate (EXP) isocyanuric acid (EXP) isoliquiritigenin (EXP) isoniazide (EXP) ketamine (ISO) ketoconazole (EXP) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) lead diacetate (EXP) lead(0) (EXP) lidocaine (EXP) linoleic acid (ISO) lipoic acid (EXP,ISO) lipopolysaccharide (ISO) lisinopril dihydrate (EXP) losartan (EXP) lycopene (ISO) madecassoside (ISO) maleic acid (EXP) meglumine amidotrizoate (EXP) melamine (EXP) melatonin (ISO) menadione (ISO) mercury atom (EXP) mercury dichloride (EXP,ISO) mercury(0) (EXP) metformin (EXP) methamphetamine (ISO) methylmercury chloride (EXP,ISO) N-acetyl-L-cysteine (EXP,ISO) N-nitrosodiethylamine (EXP) natamycin (ISO) nicorandil (EXP) nicotine (ISO) nifedipine (EXP) nitric oxide (EXP) nitrofen (EXP) nystatin (ISO) ochratoxin A (EXP,ISO) oleic acid (ISO) Ondansetron (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (ISO) patulin (EXP) Pentoxifylline (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (ISO) phenol (ISO) phenylbutazone (EXP) phenylmercury acetate (ISO) Phytolaccoside E (ISO) pinostrobin (EXP) pirinixic acid (ISO) polymyxin B2 (ISO) Potassium 2,6-dihydroxytriazinecarboxylate (ISO) potassium bromate (EXP) potassium dichromate (EXP) probenecid (ISO) quercetin (ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) Salinomycin (ISO) salubrinal (ISO) SB 431542 (ISO) sirolimus (EXP) sodium arsenite (EXP,ISO) sodium cholate (EXP) sodium fluoride (EXP) streptozocin (EXP,ISO) sulforaphane (ISO) tacrolimus hydrate (EXP) tannic acid (EXP) tartrazine (EXP) tenofovir disoproxil fumarate (ISO) testosterone (EXP,ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) tetramethylpyrazine (EXP) thallium (EXP) thallium sulfate (EXP) thioacetamide (EXP) titanium dioxide (ISO) trans-anethole (EXP) trichloroethene (EXP) umbelliferone (EXP) urethane (ISO) vancomycin (EXP,ISO) vildagliptin (EXP) Vinpocetine (EXP) XAV939 (ISO) xylazine (ISO) zinc atom (ISO) zinc protoporphyrin (EXP) zinc(0) (ISO) zoledronic acid (ISO)
1.
Urinary NGAL and KIM-1: biomarkers for assessment of acute ischemic kidney injury following nephron sparing surgery.
Abassi Z, etal., J Urol. 2013 Apr;189(4):1559-66. doi: 10.1016/j.juro.2012.10.029. Epub 2012 Oct 22.
2.
Macrophage infiltration and renal damage are independent of matrix metalloproteinase 12 in the obstructed kidney.
Abraham AP, etal., Nephrology (Carlton). 2012 May;17(4):322-9. doi: 10.1111/j.1440-1797.2012.01567.x.
3.
Early urinary and plasma biomarkers for experimental diabetic nephropathy.
Alter ML, etal., Clin Lab. 2012;58(7-8):659-71.
4.
Fructose induces tubulointerstitial injury in the kidney of mice.
Aoyama M, etal., Biochem Biophys Res Commun. 2012 Mar 9;419(2):244-9. doi: 10.1016/j.bbrc.2012.02.001. Epub 2012 Feb 8.
5.
Urinary kidney injury molecule 1 and incidence of heart failure in elderly men.
Carlsson AC, etal., Eur J Heart Fail. 2013 Apr;15(4):441-6. doi: 10.1093/eurjhf/hfs187. Epub 2012 Dec 7.
6.
Hepatitis A virus cellular receptor 1/kidney injury molecule-1 is a susceptibility gene for clear cell renal cell carcinoma and hepatitis A virus cellular receptor/kidney injury molecule-1 ectodomain shedding a predictive biomarker of tumour progression.
Cuadros T, etal., Eur J Cancer. 2013 May;49(8):2034-47. doi: 10.1016/j.ejca.2012.12.020. Epub 2013 Jan 23.
7.
Chronic renovascular hypertension is associated with elevated levels of neutrophil gelatinase-associated lipocalin.
Eirin A, etal., Nephrol Dial Transplant. 2012 Nov;27(11):4153-61. doi: 10.1093/ndt/gfs370. Epub 2012 Aug 23.
8.
Changes of the tubular markers in type 2 diabetes mellitus with glomerular hyperfiltration.
Fu WJ, etal., Diabetes Res Clin Pract. 2012 Jan;95(1):105-9. doi: 10.1016/j.diabres.2011.09.031. Epub 2011 Oct 20.
9.
[Clinical study of kidney injury molecule-1 in the treatment of sepsis patients].
Gao LL, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2012 Nov;24(11):647-50.
10.
Structural equation modeling highlights the potential of Kim-1 as a biomarker for chronic kidney disease.
Gardiner L, etal., Am J Nephrol. 2012;35(2):152-63. doi: 10.1159/000335579. Epub 2012 Jan 20.
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
Association of atopy and eczema with polymorphisms in T-cell immunoglobulin domain and mucin domain-IL-2-inducible T-cell kinase gene cluster in chromosome 5 q 33.
Graves PE, etal., J Allergy Clin Immunol. 2005 Sep;116(3):650-6.
13.
Kidney Injury Molecule-1 (KIM-1): a novel biomarker for human renal proximal tubule injury.
Han WK, etal., Kidney Int. 2002 Jul;62(1):237-44.
14.
Urinary macrophage migration inhibitory factor serves as a potential biomarker for acute kidney injury in patients with acute pyelonephritis.
Hong MY, etal., Mediators Inflamm. 2012;2012:381358. doi: 10.1155/2012/381358. Epub 2012 Dec 23.
15.
Early detection of renal injury using urinary vanin-1 in rats with experimental colitis.
Hosohata K, etal., J Appl Toxicol. 2013 Jan 11. doi: 10.1002/jat.2849.
16.
Kidney injury molecule-1 (KIM-1), a putative epithelial cell adhesion molecule containing a novel immunoglobulin domain, is up-regulated in renal cells after injury.
Ichimura T, etal., J Biol Chem 1998 Feb 13;273(7):4135-42.
17.
Kidney injury molecule-1 is a phosphatidylserine receptor that confers a phagocytic phenotype on epithelial cells.
Ichimura T, etal., J Clin Invest. 2008 May;118(5):1657-68.
18.
Kidney injury molecule-1 and osteopontin: new markers for prediction of early kidney transplant rejection.
Jin ZK, etal., Mol Immunol. 2013 Jul;54(3-4):457-64. doi: 10.1016/j.molimm.2013.01.013. Epub 2013 Feb 27.
19.
T Cell Ig- and mucin-domain-containing molecule-3 (TIM-3) and TIM-1 molecules are differentially expressed on human Th1 and Th2 cells and in cerebrospinal fluid-derived mononuclear cells in multiple sclerosis.
Khademi M, etal., J Immunol. 2004 Jun 1;172(11):7169-76.
20.
Kidney injury molecule-1 is up-regulated in renal epithelial cells in response to oxalate in vitro and in renal tissues in response to hyperoxaluria in vivo.
Khandrika L, etal., PLoS One. 2012;7(9):e44174. doi: 10.1371/journal.pone.0044174. Epub 2012 Sep 12.
21.
Effect of combining ACE inhibition with aldosterone blockade on proteinuria and renal damage in experimental nephrosis.
Kramer AB, etal., Kidney Int. 2007 Mar;71(5):417-24. Epub 2007 Jan 10.
22.
Kidney injury molecule-1 expression in murine polycystic kidney disease.
Kuehn EW, etal., Am J Physiol Renal Physiol. 2002 Dec;283(6):F1326-36. Epub 2002 Jul 24.
23.
KIM-1 expression predicts renal outcomes in IgA nephropathy.
Kwon SH, etal., Clin Exp Nephrol. 2012 Nov 8.
24.
Myocardial infarction impairs renal function, induces renal interstitial fibrosis, and increases renal KIM-1 expression: implications for cardiorenal syndrome.
Lekawanvijit S, etal., Am J Physiol Heart Circ Physiol. 2012 May 1;302(9):H1884-93. doi: 10.¿1152/¿ajpheart.¿00967.¿2011. Epub 2012 Feb 24.
25.
Urinary Biomarkers in Relapsing Antineutrophil Cytoplasmic Antibody-associated Vasculitis.
Lieberthal JG, etal., J Rheumatol. 2013 May;40(5):674-683. Epub 2013 Apr 1.
26.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
27.
Kidney injury molecule-1 is an early noninvasive indicator for donor brain death-induced injury prior to kidney transplantation.
Nijboer WN, etal., Am J Transplant. 2009 Aug;9(8):1752-9. Epub 2009 Jun 12.
28.
Vitamin D and calcium co-therapy mitigates pre-established cadmium nephropathy by regulating renal calcium homeostatic molecules and improving anti-oxidative and anti-inflammatory activities in rat.
Obaid AA, etal., J Trace Elem Med Biol. 2023 May 24;79:127221. doi: 10.1016/j.jtemb.2023.127221.
29.
Bilirubin attenuates the renal tubular injury by inhibition of oxidative stress and apoptosis.
Oh SW, etal., BMC Nephrol. 2013 May 17;14(1):105.
30.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
31.
High urinary excretion of kidney injury molecule-1 is an independent predictor of end-stage renal disease in patients with IgA nephropathy.
Peters HP, etal., Nephrol Dial Transplant. 2011 Nov;26(11):3581-8. doi: 10.1093/ndt/gfr135. Epub 2011 Apr 5.
32.
Expression of kidney injury molecule-1 (Kim-1) in relation to necrosis and apoptosis during the early stages of Cd-induced proximal tubule injury.
Prozialeck WC, etal., Toxicol Appl Pharmacol. 2009 Aug 1;238(3):306-14. Epub 2009 Jan 31.
33.
Cardiotrophin-1 administration prevents the renal toxicity of iodinated contrast media in rats.
Quiros Y, etal., Toxicol Sci. 2013 Apr;132(2):493-501. doi: 10.1093/toxsci/kft007. Epub 2013 Jan 18.
34.
Evaluation of putative biomarkers of nephrotoxicity after exposure to ochratoxin a in vivo and in vitro.
Rached E, etal., Toxicol Sci. 2008 Jun;103(2):371-81. Epub 2008 Feb 27.
35.
GOA pipeline
RGD automated data pipeline
36.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
37.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
38.
Comprehensive gene review and curation
RGD comprehensive gene curation
39.
Kidney injury biomarkers in hypertensive, diabetic, and nephropathy rat models treated with contrast media.
Rouse RL, etal., Toxicol Pathol. 2013;41(4):662-80. doi: 10.1177/0192623312464122. Epub 2012 Oct 19.
40.
Novel assays for detection of urinary KIM-1 in mouse models of kidney injury.
Sabbisetti VS, etal., Toxicol Sci. 2013 Jan;131(1):13-25. doi: 10.1093/toxsci/kfs268. Epub 2012 Sep 27.
41.
Selenium inhibits renal oxidation and inflammation but not acute kidney injury in an animal model of rhabdomyolysis.
Shanu A, etal., Antioxid Redox Signal. 2013 Mar 1;18(7):756-69. doi: 10.1089/ars.2012.4591. Epub 2012 Oct 16.
42.
Protective Role of Testosterone in Ischemia-Reperfusion-induced Acute Kidney Injury.
Soljancic A, etal., Am J Physiol Regul Integr Comp Physiol. 2013 Apr 3.
43.
Antagonism of TIM-1 blocks the development of disease in a humanized mouse model of allergic asthma.
Sonar SS, etal., J Clin Invest. 2010 Aug 2;120(8):2767-81. doi: 10.1172/JCI39543. Epub 2010 Jul 12.
44.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
45.
Biomarkers for early detection of sickle nephropathy.
Sundaram N, etal., Am J Hematol. 2011 Jul;86(7):559-66. doi: 10.1002/ajh.22045. Epub 2011 May 31.
46.
Is urinary kidney injury molecule-1 a noninvasive marker for renal scarring in children with vesicoureteral reflux?
Toker A, etal., Urology. 2013 Jan;81(1):168-72. doi: 10.1016/j.urology.2012.09.004. Epub 2012 Nov 30.
47.
Urine NGAL and KIM-1 in children and adolescents with hyperuricemia.
Tomczak J, etal., Pediatr Nephrol. 2013 May 15.
48.
Renoprotective mechanisms of soy protein intake in the obese Zucker rat.
Trujillo J, etal., Am J Physiol Renal Physiol. 2008 Nov;295(5):F1574-82. Epub 2008 Sep 24.
49.
Regression of microalbuminuria in type 1 diabetes is associated with lower levels of urinary tubular injury biomarkers, kidney injury molecule-1, and N-acetyl-beta-D-glucosaminidase.
Vaidya VS, etal., Kidney Int. 2011 Feb;79(4):464-70. doi: 10.1038/ki.2010.404. Epub 2010 Oct 27.
50.
Tubular kidney injury molecule-1 in protein-overload nephropathy.
van Timmeren MM, etal., Am J Physiol Renal Physiol. 2006 Aug;291(2):F456-64. Epub 2006 Feb 7.
51.
Comprehensive Molecular Analyses of a Macrophage-Related Gene Signature With Regard to Prognosis, Immune Features, and Biomarkers for Immunotherapy in Hepatocellular Carcinoma Based on WGCNA and the LASSO Algorithm.
Wang T, etal., Front Immunol. 2022 May 27;13:843408. doi: 10.3389/fimmu.2022.843408. eCollection 2022.
52.
KIM-1 and NGAL: new markers of obstructive nephropathy.
Wasilewska A, etal., Pediatr Nephrol. 2011 Apr;26(4):579-86. doi: 10.1007/s00467-011-1773-5. Epub 2011 Jan 31.
53.
Differences in immunolocalization of Kim-1, RPA-1, and RPA-2 in kidneys of gentamicin-, cisplatin-, and valproic acid-treated rats: potential role of iNOS and nitrotyrosine.
Zhang J, etal., Toxicol Pathol. 2009;37(5):629-43. Epub 2009 Jun 17.
Havcr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 31,619,914 - 31,652,955 (+) NCBI GRCr8 mRatBN7.2 10 31,118,667 - 31,151,730 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 31,119,088 - 31,151,698 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 35,844,047 - 35,867,236 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 4,382,417 - 4,405,608 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 30,831,210 - 30,854,422 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 31,813,819 - 31,860,934 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 31,813,814 - 31,848,379 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 31,632,718 - 31,682,172 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 31,834,519 - 31,858,019 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 31,835,567 - 31,859,066 (+) NCBI Celera 10 30,573,361 - 30,596,533 (+) NCBI Celera Cytogenetic Map 10 q21 NCBI
HAVCR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 157,029,413 - 157,069,407 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 157,026,742 - 157,069,396 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 156,456,424 - 156,486,127 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 156,389,109 - 156,418,065 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 156,389,014 - 156,418,548 NCBI Celera 5 152,482,103 - 152,511,651 (-) NCBI Celera Cytogenetic Map 5 q33.3 NCBI HuRef 5 151,544,985 - 151,574,299 (-) NCBI HuRef CHM1_1 5 155,888,935 - 155,918,725 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 157,548,433 - 157,588,641 (-) NCBI T2T-CHM13v2.0
Havcr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 46,630,644 - 46,670,405 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 46,625,907 - 46,670,405 (+) Ensembl GRCm39 Ensembl GRCm38 11 46,739,822 - 46,779,578 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 46,735,080 - 46,779,578 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 46,553,725 - 46,593,080 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 46,594,600 - 46,622,036 (+) NCBI MGSCv36 mm8 Celera 11 51,321,716 - 51,355,068 (+) NCBI Celera Cytogenetic Map 11 B1.1 NCBI cM Map 11 28.08 NCBI
Havcr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955408 11,047,679 - 11,070,492 (-) NCBI ChiLan1.0 ChiLan1.0
HAVCR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 152,220,695 - 152,257,458 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 150,360,242 - 150,397,005 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 152,429,337 - 152,459,800 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 158,413,054 - 158,442,481 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 158,413,073 - 158,442,481 (-) Ensembl panpan1.1 panPan2
HAVCR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 53,012,223 - 53,066,611 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 53,046,970 - 53,128,952 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 53,012,234 - 53,033,393 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 52,939,224 - 52,956,256 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 53,479,175 - 53,503,280 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 53,456,833 - 53,570,712 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 53,309,862 - 53,326,891 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 53,416,885 - 53,433,922 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 53,933,785 - 53,950,850 (+) NCBI UU_Cfam_GSD_1.0
Havcr1
HAVCR1
HAVCR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 59,422,769 - 59,454,183 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 59,423,334 - 59,453,531 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 18,176,581 - 18,208,543 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Havcr1
.
Predicted Target Of
Count of predictions: 510 Count of miRNA genes: 262 Interacting mature miRNAs: 316 Transcripts: ENSRNOT00000009573 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2298480 Eau7 Experimental allergic uveoretinitis QTL 7 0.0049 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 27957626 34490668 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 631531 Iresp2 Immunoglobin response QTL2 6.3 blood immunoglobulin E amount (VT:0002492) serum immunoglobulin E level (CMO:0002101) 10 22918268 36400810 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
BQ203079
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 31,132,529 - 31,132,683 (+) MAPPER mRatBN7.2 Rnor_6.0 10 31,827,689 - 31,827,842 NCBI Rnor6.0 Rnor_5.0 10 31,648,824 - 31,648,977 UniSTS Rnor5.0 RGSC_v3.4 10 31,838,850 - 31,839,003 UniSTS RGSC3.4 Celera 10 30,577,354 - 30,577,507 UniSTS RH 3.4 Map 10 302.11 UniSTS Cytogenetic Map 10 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
19
50
78
77
46
25
46
6
167
66
30
38
40
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009573 ⟹ ENSRNOP00000009573
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 31,119,088 - 31,151,698 (+) Ensembl Rnor_6.0 Ensembl 10 31,813,814 - 31,848,379 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104970 ⟹ ENSRNOP00000076717
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 31,119,088 - 31,151,698 (+) Ensembl
RefSeq Acc Id:
NM_173149 ⟹ NP_775172
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 31,629,778 - 31,652,951 (+) NCBI mRatBN7.2 10 31,128,531 - 31,151,700 (+) NCBI Rnor_6.0 10 31,823,688 - 31,846,859 (+) NCBI Rnor_5.0 10 31,632,718 - 31,682,172 (+) NCBI RGSC_v3.4 10 31,834,519 - 31,858,019 (+) RGD Celera 10 30,573,361 - 30,596,533 (+) RGD
Sequence:
GGTGCCTGTGAGTAAATAGATCAGGGTCTCCTTCACAGCACATTCTCCAGGAAGCCGAGCAAACATTAGTGCTATTTTACCCAGGAGGAAATCTAGGTGTAGAGAGCTCTACGGATCTAAGGTTTGGA
hide sequence
RefSeq Acc Id:
XM_006246163 ⟹ XP_006246225
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 31,619,914 - 31,652,955 (+) NCBI mRatBN7.2 10 31,118,667 - 31,151,730 (+) NCBI Rnor_6.0 10 31,813,819 - 31,846,859 (+) NCBI Rnor_5.0 10 31,632,718 - 31,682,172 (+) NCBI
Sequence:
AAAGCTGGTGCAGTGGCTCAAAGTCTCTTTCTGTAGGAACCTTCTCAAAGTCAGCATGATCTCCAAACCTGGAGTCTGAACTCAAGTGAAGGCTTTTGTTGAAGCTTTAGAGATTGCCCAGCAGAAAG
hide sequence
RefSeq Acc Id:
NP_775172 ⟸ NM_173149
- Peptide Label:
precursor
- UniProtKB:
O54947 (UniProtKB/Swiss-Prot), A0A8I5Y0B2 (UniProtKB/TrEMBL), A6HDT0 (UniProtKB/TrEMBL)
- Sequence:
MVQLQVFISGLLLLLPGSVDSYEVVKGVVGHPVTIPCTYSTRGGITTTCWGRGQCPYSSCQNILIWTNGYQVTYRSSGRYNIKGRISEGDVSLTIENSVDSDSGLYCCRVEIPGWFNDQKMTFSLEVK
hide sequence
RefSeq Acc Id:
XP_006246225 ⟸ XM_006246163
- Peptide Label:
isoform X1
- UniProtKB:
G3V6W3 (UniProtKB/TrEMBL), A6HDS9 (UniProtKB/TrEMBL), A0A8I5Y0B2 (UniProtKB/TrEMBL), A6HDT0 (UniProtKB/TrEMBL)
- Sequence:
MVQLQVFISGLLLLLPGSVDSYEVVKGVVGHPVTIPCTYSTRGGITTTCWGRGQCPYSSCQNIL
hide sequence
Ensembl Acc Id:
ENSRNOP00000009573 ⟸ ENSRNOT00000009573
Ensembl Acc Id:
ENSRNOP00000076717 ⟸ ENSRNOT00000104970
RGD ID: 13697130 Promoter ID: EPDNEW_R7655 Type: multiple initiation site Name: Havcr1_1 Description: hepatitis A virus cellular receptor 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 31,814,221 - 31,814,281 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Havcr1
hepatitis A virus cellular receptor 1
Havcr1
kidney injury molecule 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Havcr1
kidney injury molecule 1
Kim1
Symbol and Name updated
1299863 APPROVED
Note Type
Note
Reference
gene_expression
expressed at a low level in normal kidney but increases dramatically in postischemic kidney
1299432
