Advanced Search (OLGA)

Gene: Acsm2 (acyl-CoA synthetase medium-chain family member 2) Rattus norvegicus

Analyze

Symbol:

Acsm2

Name:

acyl-CoA synthetase medium-chain family member 2

RGD ID:

708383

Description:

Predicted to enable benzoate-CoA ligase activity; fatty-acyl-CoA synthase activity; and medium-chain fatty acid-CoA ligase activity. Predicted to be involved in fatty acid biosynthetic process and medium-chain fatty-acyl-CoA metabolic process. Predicted to be located in mitochondrion. Predicted to be active in mitochondrial matrix. Orthologous to human ACSM2A (acyl-CoA synthetase medium chain family member 2A) and ACSM2B (acyl-CoA synthetase medium chain family member 2B); PARTICIPATES IN fatty acid beta degradation pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,2',4,4',5,5'-hexachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Acsm2a; acyl-CoA synthetase medium-chain family member 2A; acyl-coenzyme A synthetase ACSM2, mitochondrial; benzoate--CoA ligase; butyrate--CoA ligase 2; butyryl coenzyme A synthetase 2; butyryl-coenzyme A synthetase 2; kidney-specific protein (KS); kidney-specific protein KS; KS; LOC246263; middle-chain acyl-CoA synthetase 2; xenobiotic/medium-chain fatty acid:CoA ligase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	183,347,705 - 183,386,453 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	183,347,705 - 183,386,453 (+)	Ensembl				GRCr8
mRatBN7.2	1	173,916,368 - 173,955,116 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	173,916,368 - 173,955,116 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	182,231,825 - 182,270,521 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	189,417,932 - 189,456,631 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	182,153,148 - 182,193,165 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	189,289,957 - 189,329,007 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	189,289,957 - 189,395,276 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	196,227,765 - 196,266,992 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	177,830,613 - 177,869,061 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	171,667,471 - 171,705,910 (+)	NCBI		Celera
RGSC_v3.1	1	177,969,858 - 178,008,307 (+)	NCBI
Cytogenetic Map	1	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,1-dichloroethene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

ammonium chloride (EXP)

aristolochic acid A (EXP)

atrazine (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

Butralin (EXP)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

cisplatin (EXP,ISO)

clofibrate (EXP)

cyclosporin A (ISO)

D-glucose (ISO)

deoxycholic acid (ISO)

dichloroacetic acid (ISO)

dicrotophos (ISO)

fentin chloride (EXP)

flutamide (EXP)

glafenine (EXP)

glucose (ISO)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

hexadecanoic acid (ISO)

indole-3-methanol (EXP)

indometacin (EXP)

leflunomide (EXP)

melatonin (EXP,ISO)

Muraglitazar (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosomorpholine (EXP)

N-Nitrosopyrrolidine (ISO)

nefazodone (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

oxycodone (EXP)

p-toluidine (EXP)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP)

phenobarbital (ISO)

pirinixic acid (EXP)

pregnenolone 16alpha-carbonitrile (EXP,ISO)

pyrazinecarboxamide (EXP)

resveratrol (EXP,ISO)

rotenone (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

streptozocin (EXP)

tamoxifen (ISO)

tartrazine (ISO)

tetrachloromethane (EXP)

tetracycline (ISO)

thioacetamide (EXP)

trichloroethene (ISO)

triphenyl phosphate (EXP)

Triptolide (EXP)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (EXP,ISO)

urethane (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acyl-CoA metabolic process (IBA)

biological_process (ND)

fatty acid biosynthetic process (IBA)

fatty acid metabolic process (IEA)

lipid metabolic process (IEA)

long-chain fatty acid metabolic process (IEA)

medium-chain fatty-acyl-CoA metabolic process (ISO)

Cellular Component

mitochondrial matrix (IBA)

mitochondrion (IEA,ISS)

Molecular Function

acid-thiol ligase activity (IEA)

ATP binding (IEA)

benzoate-CoA ligase activity (IEA,ISS)

CoA-ligase activity (IEA)

decanoate-CoA ligase activity (IEA)

fatty acid ligase activity (IBA)

fatty-acyl-CoA synthase activity (IBA)

ligase activity (IEA)

medium-chain fatty acid-CoA ligase activity (IEA,ISO)

metal ion binding (IEA)

nucleotide binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

fatty acid beta degradation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Molecular cloning of KS, a novel rat gene expressed exclusively in the kidney.	Hilgers KF, etal., Kidney Int 1998 Nov;54(5):1444-54.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.	Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome.	Watkins PA, etal., J Lipid Res. 2007 Dec;48(12):2736-50. Epub 2007 Aug 30.

Additional References at PubMed

PMID:18614015	PMID:19345228

Genomics

Comparative Map Data

Acsm2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	183,347,705 - 183,386,453 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	183,347,705 - 183,386,453 (+)	Ensembl				GRCr8
mRatBN7.2	1	173,916,368 - 173,955,116 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	173,916,368 - 173,955,116 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	182,231,825 - 182,270,521 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	189,417,932 - 189,456,631 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	182,153,148 - 182,193,165 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	189,289,957 - 189,329,007 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	189,289,957 - 189,395,276 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	196,227,765 - 196,266,992 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	177,830,613 - 177,869,061 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	171,667,471 - 171,705,910 (+)	NCBI		Celera
RGSC_v3.1	1	177,969,858 - 178,008,307 (+)	NCBI
Cytogenetic Map	1	q35	NCBI

ACSM2A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	20,451,521 - 20,487,669 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	20,444,012 - 20,487,669 (+)	Ensembl			hg38	GRCh38
GRCh37	16	20,462,843 - 20,498,991 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	20,370,360 - 20,406,492 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	16	19,617,914 - 19,631,073 (+)	NCBI		Celera
Celera	16	19,790,180 - 19,797,288 (-)	NCBI		Celera
Cytogenetic Map	16	p12.3	NCBI
HuRef	16	18,999,519 - 19,035,632 (+)	NCBI		HuRef
CHM1_1	16	20,551,160 - 20,587,291 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	20,382,562 - 20,418,674 (+)	NCBI		T2T-CHM13v2.0

Acsm2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	119,153,563 - 119,199,917 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	119,153,563 - 119,199,913 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	119,554,340 - 119,600,694 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	119,554,340 - 119,600,690 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	126,697,854 - 126,744,208 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	119,352,881 - 119,387,329 (+)	NCBI		MGSCv36	mm8
Celera	7	119,472,012 - 119,518,406 (+)	NCBI		Celera
Cytogenetic Map	7	F2	NCBI
cM Map	7	63.97	NCBI

LOC479822
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	24,864,952 - 24,893,830 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	39,180,062 - 39,208,987 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	25,021,437 - 25,050,364 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	6	24,822,297 - 24,851,221 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	24,717,429 - 24,746,348 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	25,105,579 - 25,134,524 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

ACSM2B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	3	25,357,943 - 25,387,843 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	26,138,057 - 26,166,416 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants

Variants in Acsm2
348 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	153679879	198679879	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	177339686	222339686	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	181059071	226059071	Rat
61326	Eae6	Experimental allergic encephalomyelitis QTL 6	5.3		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	182383862	191260518	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	181059071	226059071	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	153679879	205813246	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	182039247	227039247	Rat
8694166	Bw147	Body weight QTL 147	6.83	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	1	153788989	198788989	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	160573753	210707719	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	181059071	226059071	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	160573753	210707719	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	165278545	210278545	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	161077990	206077990	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	181059071	226059071	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	168063662	213063662	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	159894717	207261263	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	163992710	208992710	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	182535316	227535316	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	155359438	194575574	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	181059071	226059071	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	140833106	185833106	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	181059071	226059071	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	162753891	207753891	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	180739993	225739993	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	153680016	183564652	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	172718770	228180370	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	175967553	200707874	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	178547286	206690557	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	210707719	Rat
1576310	Schws2	Schwannoma susceptibility QTL 2		0.029	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	1	153788989	198788989	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	165707719	210707719	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	173363824	227535316	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	140915717	185915717	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
7411599	Foco11	Food consumption QTL 11	18.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	1	153788989	198788989	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	210707719	Rat

Markers in Region

RH134354

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	173,954,863 - 173,955,063 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	189,328,755 - 189,328,954	NCBI	Rnor6.0
Rnor_5.0	1	196,266,740 - 196,266,939	UniSTS	Rnor5.0
RGSC_v3.4	1	177,868,809 - 177,869,008	UniSTS	RGSC3.4
Celera	1	171,705,658 - 171,705,857	UniSTS
Cytogenetic Map	1	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
11	8	22	61	86	89	59	29	59	6	221	66	45	77	54	30

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_144748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF062389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020587 ⟹ ENSRNOP00000020587

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	183,347,705 - 183,386,453 (+)	Ensembl
mRatBN7.2 Ensembl	1	173,916,368 - 173,955,116 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106466 ⟹ ENSRNOP00000092168

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	183,347,705 - 183,386,453 (+)	Ensembl
mRatBN7.2 Ensembl	1	173,916,368 - 173,955,116 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000127884 ⟹ ENSRNOP00000111177

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	183,348,357 - 183,386,453 (+)	Ensembl

RefSeq Acc Id:

NM_144748 ⟹ NP_653349

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	183,347,705 - 183,386,453 (+)	NCBI
mRatBN7.2	1	173,916,368 - 173,955,116 (+)	NCBI
Rnor_6.0	1	189,289,957 - 189,329,007 (+)	NCBI
Rnor_5.0	1	196,227,765 - 196,266,992 (+)	NCBI
RGSC_v3.4	1	177,830,613 - 177,869,061 (+)	RGD
Celera	1	171,667,471 - 171,705,910 (+)	RGD

Sequence:

show sequence

CATCAGTGCTGTTCTCTCTACTGGTGCTTCGGGAACTCTAGAACTCCTTCCTGAGAGGGAAGCA
AACCAAGCTATTGCCAGAGAGAGTTCCATAAGAGCTCTGAATATGCATTGGCTGTGGAAAATTC
CAAGACTTTGCACCTTCTGGGGCACTGAGATGTTCCACCGTTCTTTCCATATGAATATCAAGAA
ACTAATGCCCATACAGTGGGGCCACCAAGAAGTCCCTGCCAAGTTCAACTTCGCTAGTGATGTG
ATAGATCACTGGGCCAGCCTGGAGAAGGCTGGCAAGAGATCTCCAGGTCCAGCCCTATGGTGGA
TGAATGGCAGTGGGGAAGAACTAAAGTGGAACTTCAGAGAACTGAGTGAAATCAGTAAACAGAC
GGCCAATGTTCTCACCGGGGCCTGTGGCCTGCAGCGTGGGGACCGTGTAGCAGTAGTGCTTCCT
CGAGTCCCAGAGTGGTGGCTGGTGACCCTCGGCTGCATGCGTTCTGGTCTTGTTTTCATGCCTG
GAACCACCCAGATGAAATCCACAGACATACTCTACAGGCTGCAATCATCCAAGGCCAGGGCCAT
TGTGGCTGGGGATGAAGTGGTTCAGGAAGTGGATGCTGTGGCCCCTGACTGCTCTTTTCTGAAA
ATCAAGTTGCTGGTGTCTGAAAAAAATCGAGAAGGATGGCTAAACTTCAAGGCACTGCTAAAGG
ATGCATCCCCCATTCATCAGTGTGTGGAGACTGTAAGCCAAGAATCAGCTGCCATCTATTTCAC
TAGCGGGACCAGTGGCCCTCCCAAGATGGCAGAGCACTCCCACTGCAGCCTGGGCCTCAAGGCC
AAGATGGATGCTGGCTGGACAGGACTGGGACCTTCTGACACAATGTGGACCATCTCAGACACAG
GCTGGATATTAAACATTTTAGGGTCATTTCTGGAACCTTGGGTATTGGGAACGTGCATATTTGT
CCATCTTTTGCCAAAGTTTGATCCACAAACTGTTCTAAAGGTGCTTTCCAGCTACCCCATCAAT
ACCCTGCTGGGTGCCCCCCTCATTTACCGGATGTTGCTACAACAGGATCTTTCCAGTTACAAGT
TCCCACATCTGCATAGCTGCTTCAGTGGAGGAGAGACCCTCCTCCCGGAGACTCTGGAGAGTTG
GAAAGCCAAGACAGGACTGGAAATCCGAGAAATCTATGGCCAGACAGAAACGGGAATTACCTGC
AGAGTTTCTAGGACAATGAAAGTCAAACCAGGCTACCTGGGAACAGCCATTGTCCCTTATGATG
TCCAGGTCATAGATGAGCAGGGCAATGTCCTGCCCCCTGGCAAGGAAGGAGACATGGCTCTCAG
GGTGAAGCCCATCAGGCCTATAGGCATGTTCTCTGGATATGTGGACAATCCCAAGAAGACACAG
GCTAATATTCGAGGAGACTTTTGGCTTCTGGGAGACCGGGGAATTAAGGATACAGAAGGGTATT
TCCACTTCATGGGACGGACAGACGATATCATTAATTCCAGTGGGTACCGAATTGGACCTTCCGA
GGTGGAGAATGCACTGATGGAACATCCTGCCGTGGTTGAAACAGCTGTGATCAGCAGCCCAGAC
CCTATCAGAAGAGAGGTGGTGAAGGCATTTGTGGTTCTAGCCCCTGAGTTCCTGTCCCATGACC
AAGACCAGCTCACCAAGGTTCTTCAGGAACACGTGAAGTCAGTGACAGCACCCTACAAGTACCC
CAGGAAGGTGGAGTTTGTCTTAGACCTGCCCAAGACCATCACAGGAAAAATTGAGCGAGCTAAA
CTTCGAGCCAAGGAATGGAAAACATCAGGATAAGCCCAGGCCCAGTGAGACTCCCAAGGCTCTT
GCTCTGTCTTTCCCAATCCTTTTCTTATGACTCCTTAGTCTTCCTATAGCAATATGAAATTATT
CATGTAGAGGCATGTATGTGATTTAGGTCTTTGCTTGGTTATTGACACAGAACAATGACACGTT
TCATGCTAAAAGAAGAAAGAAAGAGGGAATAAGAGGTTTGAAGTCAGAAAAGGCTAAAACAGCA
AGGGAAAGAAATTGCCAATTCAAGTGGTCAGGAAGGGGTAGAGAGAAGGGGAAAGCAGAATGAG
GAGAGAGAGAGATGAGAAGGAACTGGAGAGAAATAGAAAAAGGGTTGTGTAGAAGGACACTAGT
GTCTTCGCCAAGTTGTGTCAATCCTTAGGGACATCATGCCCAAAGGAGAAGGAAATACCACTTA
CAGAGCATGCCCAAGGCACTGTTATACACTTGTCATGAGTCCTATACAGGTCATGAGCCATCTT
ACTTCATCTGGGTGACATCTGCAGGCTCATCTTCTGCACCCCAAAATGTACCACTTCCTGTAGC
TCACATTTTTTGTTCTAGCTTTATTTCCTTGAATTAATAATAAAATCACTTCAAAATC

hide sequence

Protein Sequences


Protein RefSeqs	NP_653349	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD05209	(Get FASTA)	NCBI Sequence Viewer
	AAH78721	(Get FASTA)	NCBI Sequence Viewer
	EDM17658	(Get FASTA)	NCBI Sequence Viewer
	EDM17659	(Get FASTA)	NCBI Sequence Viewer
	EDM17660	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020587
GenBank Protein	O70490	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_653349 ⟸ NM_144748

- UniProtKB:

Q6AZ63 (UniProtKB/Swiss-Prot), O70490 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MHWLWKIPRLCTFWGTEMFHRSFHMNIKKLMPIQWGHQEVPAKFNFASDVIDHWASLEKAGKRS
PGPALWWMNGSGEELKWNFRELSEISKQTANVLTGACGLQRGDRVAVVLPRVPEWWLVTLGCMR
SGLVFMPGTTQMKSTDILYRLQSSKARAIVAGDEVVQEVDAVAPDCSFLKIKLLVSEKNREGWL
NFKALLKDASPIHQCVETVSQESAAIYFTSGTSGPPKMAEHSHCSLGLKAKMDAGWTGLGPSDT
MWTISDTGWILNILGSFLEPWVLGTCIFVHLLPKFDPQTVLKVLSSYPINTLLGAPLIYRMLLQ
QDLSSYKFPHLHSCFSGGETLLPETLESWKAKTGLEIREIYGQTETGITCRVSRTMKVKPGYLG
TAIVPYDVQVIDEQGNVLPPGKEGDMALRVKPIRPIGMFSGYVDNPKKTQANIRGDFWLLGDRG
IKDTEGYFHFMGRTDDIINSSGYRIGPSEVENALMEHPAVVETAVISSPDPIRREVVKAFVVLA
PEFLSHDQDQLTKVLQEHVKSVTAPYKYPRKVEFVLDLPKTITGKIERAKLRAKEWKTSG

hide sequence

Ensembl Acc Id:

ENSRNOP00000020587 ⟸ ENSRNOT00000020587

Ensembl Acc Id:

ENSRNOP00000092168 ⟸ ENSRNOT00000106466

Ensembl Acc Id:

ENSRNOP00000111177 ⟸ ENSRNOT00000127884

Protein Domains

AMP-binding enzyme C-terminal AMP-dependent synthetase/ligase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O70490-F1-model_v2	AlphaFold	O70490	1-572	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690351

Promoter ID:

EPDNEW_R876

Type:

multiple initiation site

Name:

Acsm2_2

Description:

acyl-CoA synthetase medium-chain family member 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R878

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	189,289,961 - 189,290,021	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708383	AgrOrtholog
BioCyc Gene	G2FUF-57651	BioCyc
BioCyc Pathway	FAO-PWY [fatty acid beta-oxidation I (generic)]	BioCyc
	PWY-5143 [long-chain fatty acid activation]	BioCyc
	PWY-5972 [stearate biosynthesis I (animals)]	BioCyc
	PWY-6000 [gamma-linolenate biosynthesis II (animals)]	BioCyc
	PWY-7049 [icosapentaenoate biosynthesis II (6-desaturase, mammals)]	BioCyc
	PWY-8181 [2-methyl-branched fatty acid beta-oxidation]	BioCyc
	PWY3DJ-11470 [sphingosine and sphingosine-1-phosphate metabolism]	BioCyc
	PWY66-387 [3-methyl-branched fatty acid alpha-oxidation]	BioCyc
	PWY66-388 [ceramide degradation by alpha-oxidation]	BioCyc
	PWY66-389 [phytol degradation]	BioCyc
	PWY66-391 [fatty acid beta-oxidation VI (mammalian peroxisome)]	BioCyc
BioCyc Pathway Image	FAO-PWY	BioCyc
	PWY-5143	BioCyc
	PWY-5972	BioCyc
	PWY-6000	BioCyc
	PWY-7049	BioCyc
	PWY-8181	BioCyc
	PWY3DJ-11470	BioCyc
	PWY66-387	BioCyc
	PWY66-388	BioCyc
	PWY66-389	BioCyc
	PWY66-391	BioCyc
Ensembl Genes	ENSRNOG00000042084	Ensembl
	ENSRNOG00000064951	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000020587	ENTREZGENE
Gene3D-CATH	3.30.300.30	UniProtKB/Swiss-Prot
	3.40.50.12780	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7110246	IMAGE-MGC_LOAD
InterPro	AMP-bd_C	UniProtKB/Swiss-Prot
	AMP-bd_C_sf	UniProtKB/Swiss-Prot
	AMP-binding_CS	UniProtKB/Swiss-Prot
	AMP-dep_Synth/Lig	UniProtKB/Swiss-Prot
	AMP-dep_Synthh-like_sf	UniProtKB/Swiss-Prot
	Mitochondrial_ACSM	UniProtKB/Swiss-Prot
KEGG Report	rno:246263	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93153	IMAGE-MGC_LOAD
NCBI Gene	246263	ENTREZGENE
PANTHER	ACYL-COENZYME A SYNTHETASE	UniProtKB/Swiss-Prot
	ACYL-COENZYME A SYNTHETASE ACSM2B, MITOCHONDRIAL	UniProtKB/Swiss-Prot
Pfam	AMP-binding	UniProtKB/Swiss-Prot
	AMP-binding_C	UniProtKB/Swiss-Prot
PhenoGen	Acsm2	PhenoGen
PROSITE	AMP_BINDING	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000042084	RatGTEx
	ENSRNOG00000064951	RatGTEx
Superfamily-SCOP	Acetyl-CoA synthetase-like	UniProtKB/Swiss-Prot
UniProt	A0A0G2JSN9_RAT	UniProtKB/TrEMBL
	A0A0G2K125_RAT	UniProtKB/TrEMBL
	A0A8I6AF03_RAT	UniProtKB/TrEMBL
	A0ABK0LJS5_RAT	UniProtKB/TrEMBL
	ACSM2_RAT	UniProtKB/Swiss-Prot
	F1M1W1_RAT	UniProtKB/TrEMBL
	O70490	ENTREZGENE
	Q6AZ63	ENTREZGENE
UniProt Secondary	Q6AZ63	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-10-17	Acsm2	acyl-CoA synthetase medium-chain family member 2	Acsm2a	acyl-CoA synthetase medium-chain family member 2A	Name and Symbol changed	629549	APPROVED
2012-01-09	Acsm2a	acyl-CoA synthetase medium-chain family member 2A	Acsm2	acyl-CoA synthetase medium-chain family member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-27	Acsm2	acyl-CoA synthetase medium-chain family member 2	Acsm2a	acyl-CoA synthetase medium-chain family member 2A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-10	Acsm2a	acyl-CoA synthetase medium-chain family member 2A	Acsm2a	acyl-CoA synthetase medium-chain family member 2a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Acsm2a	acyl-CoA synthetase medium-chain family member 2a	LOC246263	kidney-specific protein (KS)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-09-30	LOC246263				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

BioCyc Pathways

Send us a Message

RGD Manual Annotations

BioCyc Pathways