Symbol:
Crhr2
Name:
corticotropin releasing hormone receptor 2
RGD ID:
70547
Description:
Enables corticotropin-releasing hormone receptor activity and peptide hormone binding activity. Involved in several processes, including negative regulation of secretion; regulation of intracellular signal transduction; and regulation of macromolecule biosynthetic process. Located in several cellular components, including axon; cell body fiber; and perikaryon. Used to study colitis; ischemia; and muscular atrophy. Biomarker of colitis; depressive disorder; functional colonic disease; and irritable bowel syndrome. Human ortholog(s) of this gene implicated in asthma. Orthologous to human CRHR2 (corticotropin releasing hormone receptor 2); PARTICIPATES IN protein kinase A (PKA) signaling pathway; corticotropin-releasing hormone signaling pathway; G protein mediated signaling pathway via Galphas family; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; ammonium acetate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
corticotrophin releasing hormone receptor 2; corticotropin-releasing factor receptor 2; corticotropin-releasing factor receptor subtype 2; corticotropin-releasing hormone receptor 2; CRF-R 2; CRF-R-2; CRF-R2; CRF2; Crf2r; CRFR-2; CRH-R 2; CRH-R-2; CRH-R2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CRHR2 (corticotropin releasing hormone receptor 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Crhr2 (corticotropin releasing hormone receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Crhr2 (corticotropin releasing hormone receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CRHR2 (corticotropin releasing hormone receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CRHR2 (corticotropin releasing hormone receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Crhr2 (corticotropin releasing hormone receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CRHR2 (corticotropin releasing hormone receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CRHR2 (corticotropin releasing hormone receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Crhr2 (corticotropin releasing hormone receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CRHR1 (corticotropin releasing hormone receptor 1) HGNC
OrthoDB
Homo sapiens (human):
ADAT1 (adenosine deaminase tRNA specific 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CRHR2 (corticotropin releasing hormone receptor 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Crhr2 (corticotropin releasing hormone receptor 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Dh44-R1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
crhr2
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER|PhylomeDB)
Candidate Gene For:
Alc18 Alc21 Alc22 Bw126
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 85,553,163 - 85,596,203 (-) NCBI GRCr8 mRatBN7.2 4 84,222,897 - 84,265,924 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 84,224,002 - 84,265,904 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 89,447,028 - 89,474,226 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 85,222,449 - 85,249,647 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 83,634,840 - 83,661,994 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 85,286,371 - 85,329,374 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 85,286,372 - 85,329,362 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 149,943,615 - 149,986,646 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 83,839,822 - 83,867,017 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 84,085,174 - 84,112,370 (+) NCBI Celera 4 79,091,140 - 79,118,337 (-) NCBI Celera Cytogenetic Map 4 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Crhr2 Rat 17alpha-ethynylestradiol affects expression ISO Crhr2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of CRHR2 mRNA CTD PMID:17555576 Crhr2 Rat 17beta-estradiol decreases expression ISO Crhr2 (Mus musculus) 6480464 Estradiol results in decreased expression of CRHR2 mRNA CTD PMID:39298647 Crhr2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Crhr2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Crhr2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Crhr2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Crhr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CRHR2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CRHR2 mRNA CTD PMID:21296121 Crhr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CRHR2 mRNA CTD PMID:20558275 and PMID:33387578 Crhr2 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Crhr2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CRHR2 mRNA CTD PMID:26251327 Crhr2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CRHR2 mRNA CTD PMID:24780913 Crhr2 Rat 6-propyl-2-thiouracil multiple interactions ISO Crhr2 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in increased expression of CRHR2 mRNA CTD PMID:36706583 Crhr2 Rat ammonium acetate increases expression EXP 6480464 ammonium acetate results in increased expression of CRHR2 mRNA CTD PMID:33404927 Crhr2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CRHR2 mRNA CTD PMID:16483693 Crhr2 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of CRHR2 protein CTD PMID:18585412 Crhr2 Rat antirheumatic drug increases expression ISO CRHR2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of CRHR2 mRNA CTD PMID:24449571 Crhr2 Rat arsane affects methylation ISO CRHR2 (Homo sapiens) 6480464 Arsenic affects the methylation of CRHR2 gene CTD PMID:25304211 Crhr2 Rat arsenic atom affects methylation ISO CRHR2 (Homo sapiens) 6480464 Arsenic affects the methylation of CRHR2 gene CTD PMID:25304211 Crhr2 Rat astressin multiple interactions ISO CRHR2 (Homo sapiens) 6480464 astressin binds to and results in decreased activity of CRHR2 protein CTD PMID:16014403 Crhr2 Rat atrazine increases expression ISO CRHR2 (Homo sapiens) 6480464 Atrazine results in increased expression of CRHR2 mRNA CTD PMID:22378314 Crhr2 Rat Azoxymethane multiple interactions ISO Crhr2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CRHR2 mRNA CTD PMID:29950665 Crhr2 Rat benzo[a]pyrene increases expression ISO Crhr2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CRHR2 mRNA CTD PMID:27195522 Crhr2 Rat benzo[a]pyrene increases methylation ISO CRHR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CRHR2 exon CTD PMID:27901495 Crhr2 Rat benzo[a]pyrene increases methylation ISO Crhr2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of CRHR2 intron CTD PMID:27901495 Crhr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CRHR2 mRNA CTD PMID:25181051 Crhr2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CRHR2 gene CTD PMID:28505145 Crhr2 Rat carbon nanotube decreases expression ISO Crhr2 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of CRHR2 mRNA CTD PMID:25620056 Crhr2 Rat CGP 52608 multiple interactions ISO CRHR2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CRHR2 gene] CTD PMID:28238834 Crhr2 Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of CRHR2 protein CTD PMID:16614059 Crhr2 Rat dextran sulfate multiple interactions ISO Crhr2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CRHR2 mRNA CTD PMID:29950665 Crhr2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of CRHR2 mRNA CTD PMID:15620428 Crhr2 Rat dichlorine increases expression EXP 6480464 Chlorine results in increased expression of CRHR2 mRNA CTD PMID:18636392 Crhr2 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of CRHR2 mRNA CTD PMID:18636392 Crhr2 Rat Dicyclohexyl phthalate increases expression EXP 6480464 dicyclohexyl phthalate results in increased expression of CRHR2 mRNA CTD PMID:15620428 Crhr2 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of CRHR2 mRNA CTD PMID:37077353 Crhr2 Rat diiodine multiple interactions ISO Crhr2 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in increased expression of CRHR2 mRNA CTD PMID:36706583 Crhr2 Rat genistein increases expression ISO Crhr2 (Mus musculus) 6480464 Genistein results in increased expression of CRHR2 mRNA CTD PMID:22553218 Crhr2 Rat hydrogen cyanide decreases expression ISO Crhr2 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of CRHR2 mRNA CTD PMID:33914522 Crhr2 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of CRHR2 mRNA CTD PMID:37077353 Crhr2 Rat lead diacetate increases expression ISO Crhr2 (Mus musculus) 6480464 lead acetate results in increased expression of CRHR2 mRNA CTD PMID:22613225 Crhr2 Rat lipopolysaccharide multiple interactions ISO CRHR2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CRHR2 mRNA CTD PMID:35811015 Crhr2 Rat mono(2-ethylhexyl) phthalate increases expression ISO Crhr2 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of CRHR2 mRNA CTD PMID:22401849 Crhr2 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of CRHR2 mRNA CTD PMID:18636392 Crhr2 Rat PCB138 multiple interactions ISO Crhr2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Crhr2 Rat pioglitazone multiple interactions ISO Crhr2 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of CRHR2 mRNA CTD PMID:27935865 Crhr2 Rat pirinixic acid multiple interactions ISO Crhr2 (Mus musculus) 6480464 NCF1 protein promotes the reaction [pirinixic acid results in decreased expression of CRHR2 mRNA] CTD PMID:17950772 Crhr2 Rat pirinixic acid decreases expression ISO Crhr2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of CRHR2 mRNA CTD PMID:17950772 Crhr2 Rat potassium cyanide increases expression ISO Crhr2 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of CRHR2 mRNA CTD PMID:33914522 Crhr2 Rat procymidone decreases expression EXP 6480464 procymidone results in decreased expression of CRHR2 mRNA CTD PMID:15686871 Crhr2 Rat resveratrol multiple interactions ISO CRHR2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of CRHR2 mRNA CTD PMID:23557933 Crhr2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CRHR2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CRHR2 mRNA CTD PMID:35811015 Crhr2 Rat silicon dioxide increases expression ISO CRHR2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of CRHR2 mRNA CTD PMID:25895662 Crhr2 Rat sodium arsenite increases expression ISO CRHR2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CRHR2 mRNA CTD PMID:38568856 Crhr2 Rat tamoxifen affects expression ISO Crhr2 (Mus musculus) 6480464 Tamoxifen affects the expression of CRHR2 mRNA CTD PMID:17555576 Crhr2 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of CRHR2 mRNA CTD PMID:12734012 Crhr2 Rat titanium dioxide decreases expression ISO Crhr2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of CRHR2 mRNA CTD PMID:23557971 and PMID:29264374 Crhr2 Rat titanium dioxide decreases methylation ISO Crhr2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CRHR2 gene CTD PMID:35295148 Crhr2 Rat titanium dioxide multiple interactions ISO Crhr2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CRHR2 mRNA CTD PMID:29950665 Crhr2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of CRHR2 mRNA CTD PMID:15686871
17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 6-propyl-2-thiouracil (EXP,ISO) ammonium acetate (EXP) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) astressin (ISO) atrazine (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) carbon nanotube (ISO) CGP 52608 (ISO) cyclophosphamide (EXP) dextran sulfate (ISO) dibutyl phthalate (EXP) dichlorine (EXP) Dicyclohexyl phthalate (EXP) diethylstilbestrol (EXP) diiodine (ISO) genistein (ISO) hydrogen cyanide (ISO) ketoconazole (EXP) lead diacetate (ISO) lipopolysaccharide (ISO) mono(2-ethylhexyl) phthalate (ISO) ozone (EXP) PCB138 (ISO) pioglitazone (ISO) pirinixic acid (ISO) potassium cyanide (ISO) procymidone (EXP) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) tamoxifen (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) vinclozolin (EXP)
1.
Alterations in the central CRF system of two different rat models of comorbid depression and functional gastrointestinal disorders.
Bravo JA, etal., Int J Neuropsychopharmacol. 2011 Jun;14(5):666-83. Epub 2010 Sep 22.
2.
Antalarmin blockade of corticotropin releasing hormone-induced hypertension in rats.
Briscoe RJ, etal., Brain Res. 2000 Oct 27;881(2):204-7.
3.
[cDNA cloning and analysis of tissue-specific gene expression of rat urocortin II].
Chae JI, etal., Mol Biol (Mosk). 2009 Jan-Feb;43(1):91-6.
4.
Urocortin 1 modulates immunosignaling in a rat model of colitis via corticotropin-releasing factor receptor 2.
Chang J, etal., Am J Physiol Gastrointest Liver Physiol. 2011 May;300(5):G884-94. Epub 2011 Feb 17.
5.
Urocortin 2 expression in the rat gastrointestinal tract under basal conditions and in chemical colitis.
Chang J, etal., Peptides. 2007 Jul;28(7):1453-60. Epub 2007 May 21.
6.
Des-acyl ghrelin acts by CRF type 2 receptors to disrupt fasted stomach motility in conscious rats.
Chen CY, etal., Gastroenterology. 2005 Jul;129(1):8-25.
7.
Abnormal adaptations to stress and impaired cardiovascular function in mice lacking corticotropin-releasing hormone receptor-2.
Coste SC, etal., Nat Genet 2000 Apr;24(4):403-9.
8.
Neuroanatomical evidence for reciprocal regulation of the corticotrophin-releasing factor and oxytocin systems in the hypothalamus and the bed nucleus of the stria terminalis of the rat: Implications for balancing stress and affect.
Dabrowska J, etal., Psychoneuroendocrinology. 2011 Oct;36(9):1312-26. Epub 2011 Apr 9.
9.
Corticotropin-releasing factor (CRF) and the urocortins differentially regulate catecholamine secretion in human and rat adrenals, in a CRF receptor type-specific manner.
Dermitzaki E, etal., Endocrinology. 2007 Apr;148(4):1524-38. Epub 2006 Dec 28.
10.
Maternal deprivation alters epithelial secretory cell lineages in rat duodenum: role of CRF-related peptides.
Estienne M, etal., Gut. 2010 Jun;59(6):744-51.
11.
Gestational hypoxia alone or combined with restraint sensitizes the hypothalamic-pituitary-adrenal axis and induces anxiety-like behavior in adult male rat offspring.
Fan JM, etal., Neuroscience. 2009 Apr 10;159(4):1363-73. Epub 2009 Feb 12.
12.
Activation of the nociceptin/orphanin FQ system is unable to reverse CRF2 receptor mediated anorexia in the rat.
Fedeli A, etal., Peptides. 2006 Dec;27(12):3284-91. Epub 2006 Oct 16.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
The dynamic developmental localization of the full-length corticotropin-releasing factor receptor type 2 in rat cerebellum.
Gounko NV, etal., Eur J Neurosci. 2006 Jun;23(12):3217-24.
16.
Activation of corticotropin-releasing factor receptor 2 mediates the colonic motor coping response to acute stress in rodents.
Gourcerol G, etal., Gastroenterology. 2011 May;140(5):1586-96.e6. Epub 2011 Jan 26.
17.
Cocaine withdrawal enhances long-term potentiation in rat hippocampus via changing the activity of corticotropin-releasing factor receptor subtype 2.
Guan X, etal., Neuroscience. 2009 Jul 7;161(3):665-70. Epub 2009 Apr 17.
18.
The molecular mechanisms underlying the regulation of the biological activity of corticotropin-releasing hormone receptors: implications for physiology and pathophysiology.
Hillhouse EW and Grammatopoulos DK, Endocr Rev. 2006 May;27(3):260-86. Epub 2006 Feb 16.
19.
Treatment with a corticotrophin releasing factor 2 receptor agonist modulates skeletal muscle mass and force production in aged and chronically ill animals.
Hinkle RT, etal., BMC Musculoskelet Disord. 2011 Jan 14;12:15.
20.
Urocortin induces interleukin-6 release from rat cardiomyocytes through p38 MAP kinase, ERK and NF-kappaB activation.
Huang M, etal., J Mol Endocrinol. 2009 May;42(5):397-405. Epub 2009 Feb 11.
21.
Glucocorticoids differentially regulate the expression of CRFR1 and CRFR2alpha in MIN6 insulinoma cells and rodent islets.
Huising MO, etal., Endocrinology. 2011 Jan;152(1):138-50. Epub 2010 Nov 24.
22.
[Analgesic effect of corticotropin releasing factor (CRF) on somatic pain sensitivity: participation of glucocorticoid and CRF-2 receptors].
Iarushkina NI, etal., Ross Fiziol Zh Im I M Sechenova. 2008 Oct;94(10):1118-25.
23.
Effects of urocortin II on neonatal rat cardiac myocytes and non-myocytes.
Ikeda K, etal., Peptides. 2005 Dec;26(12):2473-81. Epub 2005 Jul 7.
24.
Corticotropin-releasing hormone receptor-1 and 2 activity produces divergent resistance against stress-induced pulmonary Streptococcus pneumoniae infection.
Kim BJ, etal., J Neuroimmunol. 2011 Jul 18.
25.
Over-expression of neuropeptide urocortin and its receptors in human allergic nasal mucosa.
Kim TH, etal., Laryngoscope. 2007 Sep;117(9):1513-8.
26.
Corticotrophin-releasing factor alters the timing of puberty in the female rat.
Kinsey-Jones JS, etal., J Neuroendocrinol. 2010 Feb;22(2):102-9. Epub 2009 Dec 4.
27.
Deletion of crhr2 reveals an anxiolytic role for corticotropin-releasing hormone receptor-2.
Kishimoto T, etal., Nat Genet 2000 Apr;24(4):415-9.
28.
Urocortin 3 regulates glucose-stimulated insulin secretion and energy homeostasis.
Li C, etal., Proc Natl Acad Sci U S A. 2007 Mar 6;104(10):4206-11. Epub 2007 Feb 27.
29.
Excitatory responses of cardiovascular activities to urocortin3 administration into the PVN of the rat.
Li X, etal., Auton Neurosci. 2010 Apr 19;154(1-2):108-11. Epub 2010 Jan 8.
30.
Cloning and characterization of a functionally distinct corticotropin-releasing factor receptor subtype from rat brain.
Lovenberg TW, etal., Proc Natl Acad Sci U S A 1995 Jan 31;92(3):836-40.
31.
Dopamine-dependent responses to cocaine depend on corticotropin-releasing factor receptor subtypes.
Lu L, etal., J Neurochem 2003 Mar;84(6):1378-86.
32.
Topographical distribution of corticotropin-releasing factor type 2 receptor-like immunoreactivity in the rat dorsal raphe nucleus: co-localization with tryptophan hydroxylase.
Lukkes JL, etal., Neuroscience. 2011 Jun 2;183:47-63. Epub 2011 Mar 29.
33.
The use of H-2 mutants as models for the study of T cell activation.
McKenzie IF, etal., Immunol Rev 1977;35:179-230.
34.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
35.
Activation of corticotropin-releasing factor receptor-2 causes bronchorelaxation and inhibits pulmonary inflammation in mice.
Moffatt JD, etal., FASEB J. 2006 Sep;20(11):1877-9. Epub 2006 Jul 19.
36.
Urocortin stimulates tyrosine hydroxylase activity via the cAMP/protein kinase a pathway in rat Pheochromocytoma PC12 cells.
Nanmoku T, etal., Neurosci Lett. 2005 Jul 1-8;382(1-2):124-7. Epub 2005 Mar 25.
37.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
38.
Novel action of pituitary urocortin 2 in the regulation of expression and secretion of gonadotropins.
Nemoto T, etal., J Endocrinol. 2009 Apr;201(1):105-14. Epub 2009 Feb 4.
39.
Urocortin, a member of the corticotropin-releasing factor family, in normal and diseased heart.
Nishikimi T, etal., Am J Physiol Heart Circ Physiol. 2000 Dec;279(6):H3031-9.
40.
Alterations in colonic corticotropin-releasing factor receptors in the maternally separated rat model of irritable bowel syndrome: differential effects of acute psychological and physical stressors.
O'Malley D, etal., Peptides. 2010 Apr;31(4):662-70. Epub 2010 Jan 21.
41.
Urocortin, but not urocortin II, protects cultured hippocampal neurons from oxidative and excitotoxic cell death via corticotropin-releasing hormone receptor type I.
Pedersen WA, etal., J Neurosci 2002 Jan 15;22(2):404-12.
42.
Cocaine withdrawal enhances long-term potentiation induced by corticotropin-releasing factor at central amygdala glutamatergic synapses via CRF, NMDA receptors and PKA.
Pollandt S, etal., Eur J Neurosci. 2006 Sep;24(6):1733-43.
43.
Association of corticotropin-releasing hormone receptor-2 genetic variants with acute bronchodilator response in asthma.
Poon AH, etal., Pharmacogenet Genomics. 2008 May;18(5):373-82.
44.
Leptin regulates appetite-related neuropeptides in the hypothalamus of developing rats without affecting food intake.
Proulx K, etal., Endocrinology 2002 Dec;143(12):4683-92.
45.
GOA pipeline
RGD automated data pipeline
46.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
47.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
48.
Chronic amphetamine treatment enhances corticotropin-releasing factor-induced serotonin release in the amygdala.
Scholl JL, etal., Eur J Pharmacol. 2010 Oct 10;644(1-3):80-7. Epub 2010 Jul 23.
49.
The pseudo signal peptide of the corticotropin-releasing factor receptor type 2a decreases receptor expression and prevents Gi-mediated inhibition of adenylyl cyclase activity.
Schulz K, etal., J Biol Chem. 2010 Oct 22;285(43):32878-87. Epub 2010 Aug 3.
50.
Urocortin 2 protects against retinal degeneration following bilateral common carotid artery occlusion in the rat.
Szabadfi K, etal., Neurosci Lett. 2009 May 8;455(1):42-5. Epub 2009 Mar 11.
51.
Activation of corticotropin-releasing factor 2 receptor inhibits Purkinje neuron P-type calcium currents via G(o)alpha-dependent PKC epsilon pathway.
Tao J, etal., Cell Signal. 2009 Sep;21(9):1436-43. Epub 2009 May 9.
52.
Alterations in central neuropeptide expression, release, and receptor binding in rats bred for high anxiety: critical role of vasopressin.
Wigger A, etal., Neuropsychopharmacology 2004 Jan;29(1):1-14.
53.
Alcohol-preferring rats show decreased corticotropin-releasing hormone-2 receptor expression and differences in HPA activation compared to alcohol-nonpreferring rats.
Yong W, etal., Alcohol Clin Exp Res. 2014 May;38(5):1275-83. doi: 10.1111/acer.12379. Epub 2014 Mar 10.
Crhr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 85,553,163 - 85,596,203 (-) NCBI GRCr8 mRatBN7.2 4 84,222,897 - 84,265,924 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 84,224,002 - 84,265,904 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 89,447,028 - 89,474,226 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 85,222,449 - 85,249,647 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 83,634,840 - 83,661,994 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 85,286,371 - 85,329,374 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 85,286,372 - 85,329,362 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 149,943,615 - 149,986,646 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 83,839,822 - 83,867,017 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 84,085,174 - 84,112,370 (+) NCBI Celera 4 79,091,140 - 79,118,337 (-) NCBI Celera Cytogenetic Map 4 q24 NCBI
CRHR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 30,651,942 - 30,700,103 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 30,651,942 - 30,700,129 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 30,691,558 - 30,739,719 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 30,659,388 - 30,688,665 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 30,465,439 - 30,495,136 NCBI Celera 7 30,682,041 - 30,711,309 (-) NCBI Celera Cytogenetic Map 7 p14.3 NCBI HuRef 7 30,573,396 - 30,621,616 (-) NCBI HuRef CHM1_1 7 30,691,838 - 30,739,995 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 30,789,546 - 30,837,766 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 30,741,211 - 30,789,281 (-) NCBI
Crhr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 55,067,033 - 55,110,001 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 55,067,034 - 55,110,001 (-) Ensembl GRCm39 Ensembl GRCm38 6 55,090,048 - 55,133,016 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 55,090,049 - 55,133,016 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 55,040,042 - 55,082,966 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 55,019,665 - 55,062,550 (-) NCBI MGSCv36 mm8 Celera 6 55,625,289 - 55,668,208 (-) NCBI Celera Cytogenetic Map 6 B3 NCBI cM Map 6 27.33 NCBI
Crhr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955410 31,828,506 - 31,875,100 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955410 31,830,333 - 31,874,384 (-) NCBI ChiLan1.0 ChiLan1.0
CRHR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 35,458,742 - 35,511,867 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 83,785,811 - 83,836,595 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 31,265,619 - 31,313,902 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 31,386,026 - 31,434,220 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 31,386,026 - 31,434,220 (-) Ensembl panpan1.1 panPan2
CRHR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 43,366,849 - 43,414,398 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 43,368,340 - 43,415,142 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 42,799,432 - 42,846,743 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 43,307,910 - 43,355,188 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 43,305,381 - 43,355,288 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 43,423,758 - 43,471,041 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 43,099,719 - 43,147,031 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 43,461,123 - 43,508,563 (-) NCBI UU_Cfam_GSD_1.0
Crhr2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 87,689,367 - 87,736,056 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936478 6,899,017 - 6,947,790 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936478 6,901,098 - 6,947,719 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CRHR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 42,251,749 - 42,295,467 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 42,251,755 - 42,296,457 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 46,648,683 - 46,651,308 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CRHR2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 27,703,637 - 27,738,873 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 27,708,113 - 27,739,116 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 76,965,555 - 77,000,544 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Crhr2
.
Predicted Target Of
Count of predictions: 198 Count of miRNA genes: 88 Interacting mature miRNAs: 96 Transcripts: ENSRNOT00000014925, ENSRNOT00000033672 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1549843 Bw53 Body weight QTL 53 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 103194791 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 1358363 Sradr3 Stress Responsive Adrenal Weight QTL 3 6.19 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 4 57486946 102486946 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 61364 Iddm2 Insulin dependent diabetes mellitus QTL 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 78885890 102684881 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 2306794 Ean2 Experimental allergic neuritis QTL 2 6.4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 4 83428419 95853334 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 2312569 Pur19 Proteinuria QTL 19 3.4 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 4 65882107 96130297 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1558651 Swd3 Spike wave discharge measurement QTL 3 4.62 0.000024 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 4 58432133 92991462 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631546 Bp86 Blood pressure QTL 86 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114432 91360801 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 7394826 Bw126 Body weight QTL 126 0.002 body mass (VT:0001259) body weight gain (CMO:0000420) 4 62933269 87483707 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat
D4Rat170
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 85,566,645 - 85,566,888 (+) Marker Load Pipeline mRatBN7.2 4 84,236,380 - 84,236,623 (+) MAPPER mRatBN7.2 Rnor_6.0 4 85,299,855 - 85,300,097 NCBI Rnor6.0 Rnor_5.0 4 149,957,099 - 149,957,341 UniSTS Rnor5.0 RGSC_v3.4 4 83,852,199 - 83,852,442 RGD RGSC3.4 RGSC_v3.4 4 83,852,200 - 83,852,442 UniSTS RGSC3.4 RGSC_v3.1 4 84,099,749 - 84,099,992 RGD Celera 4 79,103,518 - 79,103,762 UniSTS SHRSP x BN Map 4 41.93 UniSTS SHRSP x BN Map 4 41.93 RGD Cytogenetic Map 4 q24 UniSTS
BE120072
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 84,230,612 - 84,230,778 (+) MAPPER mRatBN7.2 Rnor_6.0 4 85,294,086 - 85,294,251 NCBI Rnor6.0 Rnor_5.0 4 149,951,330 - 149,951,495 UniSTS Rnor5.0 RGSC_v3.4 4 83,846,432 - 83,846,597 UniSTS RGSC3.4 Celera 4 79,097,750 - 79,097,915 UniSTS RH 3.4 Map 4 525.71 UniSTS Cytogenetic Map 4 q24 UniSTS
CRHR2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 85,555,513 - 85,556,052 (+) Marker Load Pipeline mRatBN7.2 4 84,225,247 - 84,225,787 (+) MAPPER mRatBN7.2 Rnor_6.0 4 85,288,722 - 85,289,260 NCBI Rnor6.0 Rnor_5.0 4 149,945,966 - 149,946,504 UniSTS Rnor5.0 RGSC_v3.4 4 83,841,068 - 83,841,606 UniSTS RGSC3.4 Celera 4 79,092,386 - 79,092,924 UniSTS Cytogenetic Map 4 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
43
41
12
17
12
6
148
89
93
30
54
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014925 ⟹ ENSRNOP00000014925
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 84,224,810 - 84,265,904 (-) Ensembl Rnor_6.0 Ensembl 4 85,286,372 - 85,329,362 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000033672 ⟹ ENSRNOP00000035712
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 84,224,002 - 84,251,198 (-) Ensembl Rnor_6.0 Ensembl 4 85,287,476 - 85,314,672 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089492 ⟹ ENSRNOP00000075129
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 84,235,707 - 84,251,198 (-) Ensembl Rnor_6.0 Ensembl 4 85,299,181 - 85,314,457 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098668 ⟹ ENSRNOP00000079784
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 84,224,002 - 84,265,904 (-) Ensembl
RefSeq Acc Id:
NM_022714 ⟹ NP_073205
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 85,554,268 - 85,581,463 (-) NCBI mRatBN7.2 4 84,224,002 - 84,251,198 (-) NCBI Rnor_6.0 4 85,287,476 - 85,314,672 (-) NCBI Rnor_5.0 4 149,943,615 - 149,986,646 (-) NCBI RGSC_v3.4 4 83,839,822 - 83,867,017 (-) RGD Celera 4 79,091,140 - 79,118,337 (-) RGD
Sequence:
GCGGCCCCTCATCTCCGTGAGCCCCGAGGCTTCTCTTGGCCAAGGTCCTAGGAGTGATCCGATTGAGAGCGGCGCCCCAAAGCTGCCGGGCTGGCCGGGGTGGGCGGGGAGGCACCTGGACGCTGCAC
hide sequence
RefSeq Acc Id:
XM_006236556 ⟹ XP_006236618
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 85,553,163 - 85,596,203 (-) NCBI mRatBN7.2 4 84,222,897 - 84,265,924 (-) NCBI Rnor_6.0 4 85,286,371 - 85,329,374 (-) NCBI Rnor_5.0 4 149,943,615 - 149,986,646 (-) NCBI
Sequence:
TGCCCTGGTGCCCAGGGCTTTACCTTGGCTGGTAGGTCGGGCAGGGTAGGACAGGCCTGGGGGAGGGGCCGGACAGACCTCCTTCCGAAGCAGCCGGCTTCTGGTCCCTATCCCTGAGCAAGCGAGTG
hide sequence
RefSeq Acc Id:
XM_006236557 ⟹ XP_006236619
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 85,553,163 - 85,596,203 (-) NCBI mRatBN7.2 4 84,222,897 - 84,265,924 (-) NCBI Rnor_6.0 4 85,286,371 - 85,329,374 (-) NCBI Rnor_5.0 4 149,943,615 - 149,986,646 (-) NCBI
Sequence:
TGCCCTGGTGCCCAGGGCTTTACCTTGGCTGGTAGGTCGGGCAGGGTAGGACAGGCCTGGGGGA
hide sequence
RefSeq Acc Id:
XM_006236558 ⟹ XP_006236620
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 85,553,163 - 85,582,627 (-) NCBI mRatBN7.2 4 84,222,897 - 84,252,290 (-) NCBI Rnor_6.0 4 85,286,371 - 85,315,108 (-) NCBI Rnor_5.0 4 149,943,615 - 149,986,646 (-) NCBI
Sequence:
TGGCGTTGTCACCAGTTCCTGGCTCCTGCTGAGAGCCATCTACCTACTCCATATTTTCTCCATCTCTCTTAGACCCTCTCTGGTAAACTGTCTGCAACCCTCCGGGGCCCCTTCAATCCATTTTCTTC
hide sequence
RefSeq Acc Id:
NP_073205 ⟸ NM_022714
- Peptide Label:
precursor
- UniProtKB:
P47866 (UniProtKB/Swiss-Prot), G3V948 (UniProtKB/Swiss-Prot)
- Sequence:
MDAALLLSLLEANCSLALAEELLLDGWGEPPDPEGPYSYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRINYSHCEPILDDKQRKYDLHYRIALIINYLGHCVSV
hide sequence
RefSeq Acc Id:
XP_006236619 ⟸ XM_006236557
- Peptide Label:
isoform X2
- UniProtKB:
D4A5C4 (UniProtKB/TrEMBL)
- Sequence:
MGTPGSLPSAQLLLCLYSLLPLLQVAQPGQALQDQPLWTLLEQYCHRTTTRNFSGPYSYCNTTL
hide sequence
RefSeq Acc Id:
XP_006236618 ⟸ XM_006236556
- Peptide Label:
isoform X1
- UniProtKB:
D4A5C4 (UniProtKB/TrEMBL), A0A8I5ZNG6 (UniProtKB/TrEMBL), A6K0W9 (UniProtKB/TrEMBL)
- Sequence:
MGTPGSLPSAQLLLCLYSLLPLLQVAQPGQALQDQPLWTLLEQYCHRTTTRNFSGPYSYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRK
hide sequence
RefSeq Acc Id:
XP_006236620 ⟸ XM_006236558
- Peptide Label:
isoform X3
- Sequence:
MDAALLLSLLEANCSLALAEELLLDGWGEPPDPEGPYSYCNTTLDQIGTCWPQSAPGALVERPC
hide sequence
Ensembl Acc Id:
ENSRNOP00000035712 ⟸ ENSRNOT00000033672
Ensembl Acc Id:
ENSRNOP00000014925 ⟸ ENSRNOT00000014925
Ensembl Acc Id:
ENSRNOP00000075129 ⟸ ENSRNOT00000089492
Ensembl Acc Id:
ENSRNOP00000079784 ⟸ ENSRNOT00000098668
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Crhr2
corticotropin releasing hormone receptor 2
corticotrophin releasing hormone receptor 2
Name updated
1299863 APPROVED
2002-06-10
Crhr2
corticotrophin releasing hormone receptor 2
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in specific regions of the brain, also in lung and heart
727728
gene_expression
expressed in hippocampal regions
70397
gene_function
G-protein coupled receptor
70397
gene_function
G-protein coupled receptor
631245
gene_process
mediates hippocampal neuron protection from stress-induced injury
70397
gene_process
mediates hippocampal neuron protection from stress-induced injury
631245
