Advanced Search (OLGA)

Gene: Galnt10 (polypeptide N-acetylgalactosaminyltransferase 10) Rattus norvegicus

Analyze

Symbol:

Galnt10

Name:

polypeptide N-acetylgalactosaminyltransferase 10

RGD ID:

69409

Description:

Predicted to enable polypeptide N-acetylgalactosaminyltransferase activity. Predicted to be involved in protein O-linked glycosylation via N-acetyl-galactosamine. Predicted to be located in Golgi membrane. Predicted to be active in Golgi apparatus. Orthologous to human GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10); PARTICIPATES IN O-linked glycan biosynthetic pathway; INTERACTS WITH 3,3',4,4',5-pentachlorobiphenyl; acrylamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

galNAc-T10; GalNAc-T9; Galnt9; LOC103693329; polypeptide GalNAc transferase 10; pp-GaNTase 10; protein-UDP acetylgalactosaminyltransferase 10; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10; udp-n-acetyl-alpha-d-galactosamine: polypeptide n-acetylgalactosaminyltransferase 10; UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase 9; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10); UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 9; uncharacterized LOC103693329

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	42,321,691 - 42,468,087 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	42,322,161 - 42,468,087 (+)	Ensembl				GRCr8
mRatBN7.2	10	41,821,216 - 41,967,618 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	41,820,158 - 41,967,013 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	46,484,468 - 46,627,402 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	45,974,720 - 46,117,663 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	41,478,345 - 41,621,282 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	43,067,316 - 43,208,992 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	43,067,299 - 43,210,427 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	42,867,364 - 43,008,297 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	43,237,411 - 43,381,584 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	41,116,176 - 41,257,585 (+)	NCBI		Celera
RGSC_v3.1	10	43,251,033 - 43,395,207 (+)	NCBI
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hereditary Neoplastic Syndromes (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-butoxyethanol (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

bleomycin A5 (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

dextran sulfate (ISO)

diethylstilbestrol (ISO)

disulfiram (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

entinostat (ISO)

fenthion (ISO)

fonofos (ISO)

formaldehyde (ISO)

glycidol (EXP)

isoflavones (ISO)

lead(0) (ISO)

mercury dibromide (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylphenidate (ISO)

monosodium L-glutamate (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

okadaic acid (ISO)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

parathion (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

progesterone (ISO)

propanal (ISO)

quercetin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

temozolomide (ISO)

terbufos (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vitamin E (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein O-linked glycosylation (IBA,IEA,ISO)

protein O-linked glycosylation via N-acetyl-galactosamine (ISO)

Cellular Component

Golgi apparatus (IBA)

Golgi membrane (IEA)

Molecular Function

carbohydrate binding (IEA)

glycosyltransferase activity (IEA)

metal ion binding (IEA)

polypeptide N-acetylgalactosaminyltransferase activity (IBA,IEA,ISO)

protein binding (ISO)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

O-linked glycan biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Cloning and characterization of a ninth member of the UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase family, ppGaNTase-T9.	Ten Hagen KG, etal., J Biol Chem 2001 May 18;276(20):17395-404.
10.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:12417297	PMID:18562306	PMID:19460755

Genomics

Comparative Map Data

Galnt10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	42,321,691 - 42,468,087 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	42,322,161 - 42,468,087 (+)	Ensembl				GRCr8
mRatBN7.2	10	41,821,216 - 41,967,618 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	41,820,158 - 41,967,013 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	46,484,468 - 46,627,402 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	45,974,720 - 46,117,663 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	41,478,345 - 41,621,282 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	43,067,316 - 43,208,992 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	43,067,299 - 43,210,427 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	42,867,364 - 43,008,297 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	43,237,411 - 43,381,584 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	41,116,176 - 41,257,585 (+)	NCBI		Celera
RGSC_v3.1	10	43,251,033 - 43,395,207 (+)	NCBI
Cytogenetic Map	10	q22	NCBI

GALNT10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	154,190,733 - 154,420,984 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	154,190,514 - 154,420,984 (+)	Ensembl			hg38	GRCh38
GRCh37	5	153,570,293 - 153,800,544 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	153,550,488 - 153,780,003 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	153,550,487 - 153,780,003	NCBI
Celera	5	149,750,055 - 149,876,200 (+)	NCBI		Celera
Cytogenetic Map	5	q33.2	NCBI
HuRef	5	148,711,113 - 148,941,366 (+)	NCBI		HuRef
CHM1_1	5	153,003,035 - 153,233,166 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	154,723,701 - 154,954,912 (+)	NCBI		T2T-CHM13v2.0

Galnt10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	57,536,268 - 57,678,327 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	57,536,268 - 57,678,340 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	57,645,442 - 57,787,514 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	57,645,442 - 57,787,514 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	57,458,944 - 57,601,003 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	57,461,637 - 57,603,696 (+)	NCBI		MGSCv36	mm8
Celera	11	62,398,045 - 62,539,186 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	35.27	NCBI

Galnt10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	8,578,725 - 8,800,800 (+)	Ensembl
ChiLan1.0	NW_004955408	8,578,725 - 8,804,562 (+)	NCBI	ChiLan1.0	ChiLan1.0

GALNT10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	149,396,891 - 149,628,220 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	147,536,436 - 147,767,765 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	149,497,998 - 149,822,999 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	155,438,451 - 155,821,214 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	155,548,799 - 155,821,214 (+)	Ensembl			panPan2	panpan1.1

GALNT10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	55,275,008 - 55,491,619 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	55,277,883 - 55,491,499 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	55,166,269 - 55,382,706 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	55,709,568 - 55,926,011 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	55,711,429 - 55,926,225 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	55,539,909 - 55,756,240 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	55,638,401 - 55,854,902 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	56,140,974 - 56,357,479 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Galnt10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	109,897,105 - 110,137,710 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936515	8,350,258 - 8,483,437 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936515	8,346,450 - 8,391,351 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GALNT10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	68,723,995 - 68,961,326 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	68,723,993 - 69,032,759 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	74,632,993 - 74,817,743 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GALNT10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	56,648,235 - 56,878,343 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	56,648,404 - 56,878,331 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666034	20,785,425 - 21,015,525 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Galnt10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	34,772,657 - 34,988,140 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624733	34,772,657 - 34,988,093 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Galnt10
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	40,443,663 - 40,513,267 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Galnt10
1452 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	126
Count of miRNA genes:	108
Interacting mature miRNAs:	117
Transcripts:	ENSRNOT00000003447
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35893451	64140567	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	18035782	63035782	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21833758	61843633	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35893263	64653589	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29800910	64653589	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	27023535	61843633	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35893263	52293000	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	18035782	63035782	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	29377046	52699134	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

D10Rat78

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	41,944,526 - 41,944,739 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	43,188,659 - 43,188,871	NCBI	Rnor6.0
Rnor_5.0	10	42,987,979 - 42,988,191	UniSTS	Rnor5.0
RGSC_v3.4	10	43,361,250 - 43,361,463	RGD	RGSC3.4
RGSC_v3.4	10	43,361,251 - 43,361,463	UniSTS	RGSC3.4
Celera	10	41,237,471 - 41,237,683	UniSTS
RGSC_v3.1	10	43,374,873 - 43,375,086	RGD
FHH x ACI Map	10	35.99	RGD
FHH x ACI Map	10	35.99	UniSTS
Cytogenetic Map	10	q22	UniSTS

BI288391

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	42,464,615 - 42,465,304 (+)	Marker Load Pipeline
mRatBN7.2	10	41,964,146 - 41,964,835 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	43,208,278 - 43,208,966	NCBI	Rnor6.0
Rnor_5.0	10	43,007,583 - 43,008,271	UniSTS	Rnor5.0
RGSC_v3.4	10	43,380,870 - 43,381,558	UniSTS	RGSC3.4
Celera	10	41,256,871 - 41,257,559	UniSTS
RH 3.4 Map	10	471.09	UniSTS
Cytogenetic Map	10	q22	UniSTS

AU047787

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	41,869,235 - 41,869,386 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	43,113,574 - 43,113,724	NCBI	Rnor6.0
Rnor_5.0	10	42,914,319 - 42,914,469	UniSTS	Rnor5.0
RGSC_v3.4	10	43,285,951 - 43,286,101	UniSTS	RGSC3.4
Celera	10	41,162,991 - 41,163,141	UniSTS
Cytogenetic Map	10	q22	UniSTS

BQ204256

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	41,950,004 - 41,950,213 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	43,194,137 - 43,194,345	NCBI	Rnor6.0
Rnor_5.0	10	42,993,457 - 42,993,665	UniSTS	Rnor5.0
RGSC_v3.4	10	43,366,729 - 43,366,937	UniSTS	RGSC3.4
Celera	10	41,242,949 - 41,243,157	UniSTS
RH 3.4 Map	10	440.2	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	92	59	6	356	192	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_130742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085105	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085109	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268358	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC132502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF241241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003447 ⟹ ENSRNOP00000003447

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	42,330,422 - 42,468,087 (+)	Ensembl
mRatBN7.2 Ensembl	10	41,820,158 - 41,967,013 (+)	Ensembl
Rnor_6.0 Ensembl	10	43,067,299 - 43,210,427 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000131733 ⟹ ENSRNOP00000103640

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	42,322,161 - 42,468,087 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000134414 ⟹ ENSRNOP00000107987

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	42,322,519 - 42,466,331 (+)	Ensembl

RefSeq Acc Id:

NM_130742 ⟹ NP_570098

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	42,322,519 - 42,468,087 (+)	NCBI
mRatBN7.2	10	41,822,043 - 41,967,618 (+)	NCBI
Rnor_6.0	10	43,067,316 - 43,208,992 (+)	NCBI
Rnor_5.0	10	42,867,364 - 43,008,297 (+)	NCBI
RGSC_v3.4	10	43,237,411 - 43,381,584 (+)	RGD
Celera	10	41,116,176 - 41,257,585 (+)	RGD

Sequence:

show sequence

ATGAGGCGCAAAGAGAAGCGGCTCTTGCAGGCGGTGGCGCTGGCTCTGGCGGCCCTTGTCCTGC
TGCCCAACGTGGGGCTCTGGGCTCTGTACCGCGAGCGGCAGCCCGACGGCAGTCCTGGGGGATC
CGGGGCGGCGGTGGCCCCGGAGGCGATACAGGAATTACACAGTCGGCAAAAAAAGACACTTTTC
TTGGGAGCTGAACAAAGGCTGAAGGACTGGCATAACAAGGAGGCTATCAGGAGGGATGCGCAGC
GCGTAGGAAATGGAGAACAGGGGAAGCCTTACCCCATGACCGATGCTGAGAGAGTGGACCAGGC
ATACCGGGAAAACGGATTTAACATCTACGTCAGTGATAAAATCTCCCTGAATCGCTCTCTCCCC
GATATCCGGCACCCAAACTGCAACAGTAAGCTTTACCTGGAGACGCTTCCCAACACCAGCATCA
TCATCCCTTTCCACAACGAGGGCTGGTCCTCACTGCTGCGCACCGTTCACAGCGTGCTCAACCG
CTCGCCCCCAGAACTCGTGGCGGAGATCGTGTTGGTCGATGACTTCAGTGACCGAGAACACCTG
AAGAAGCCACTAGAAGACTACATGGCCCTGTTCCCCAGCGTGAGGATTCTCCGGACAAAGAAAC
GGGAAGGCCTGATAAGGACCCGAATGCTGGGGGCTTCGGCCGCCACCGGAGATGTCATCACATT
CTTAGATTCACACTGTGAAGCCAACGTCAACTGGCTCCCCCCTTTGCTTGACCGCATCGCTCGG
AACCGAAAGACCATCGTGTGCCCAATGATTGACGTCATCGACCACGATGACTTCCGGTACGAGA
CACAAGCCGGGGACGCCATGCGGGGTGCCTTTGACTGGGAAATGTATTACAAACGAATCCCAAT
CCCTCCAGAGCTGCAGAAGGCGGACCCTAGTGACCCATTTGAGTCTCCTGTGATGGCCGGAGGG
CTGTTCGCTGTGGATCGGAAATGGTTCTGGGAGTTGGGCGGATACGACCCTGGCTTGGAGATCT
GGGGAGGGGAGCAGTATGAGATCTCCTTCAAGGTGTGGATGTGTGGGGGCCGCATGGAGGACAT
CCCCTGCTCCAGAGTGGGCCACATCTACAGGAAGTATGTGCCCTACAAGGTCCCTGCCGGAGTC
AGCCTGGCCAGGAACCTGAAGAGAGTGGCTGAGGTGTGGATGGATGAGTATGCAGAATACATCT
ACCAGCGCAGACCGGAATACCGCCACCTCTCAGCTGGAGACGTTGTGGCCCAGAAAAAACTCCG
AGGCTCCCTCAACTGTAAGAGCTTCAAGTGGTTTATGACCAAAATTGCCTGGGACCTGCCCAAG
TTCTACCCACCTGTGGAACCCCCGGCTGCGGCCTGGGGGGAGATTCGCAATGTGGGCACAGGAC
TGTGCACAGACACGAAGCATGGCACATTAGGCTCCCCGCTGAGGCTTGAGACCTGCATTCGGGG
CCGTGGGGAGGCTGCCTGGAACAGCATGCAGGTCTTCACCTTCACCTGGCGGGAGGACATCCGG
CCTGGAGACCCTCAACATACCAAGAAGTTCTGCTTCGACGCTGTTTCCCACACCAGCCCAGTCA
CCCTCTATGACTGCCACAGCATGAAGGGCAACCAGCTGTGGAAATACCGCAAGGACAAGACCCT
GTACCACCCTGTTAGCGGCAGCTGCATGGACTGCAGCGAAAGTGACCACAGGATCTTCATGAAC
ACCTGCAATCCCTCCTCCCTCACCCAGCAGTGGCTCTTTGAACATACCAACTCCACGGTCTTAG
AAAATTTCAACCGAAACTGA

hide sequence

RefSeq Acc Id:

XM_039085105 ⟹ XP_038941033

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	42,321,701 - 42,468,087 (+)	NCBI
mRatBN7.2	10	41,821,226 - 41,967,618 (+)	NCBI

RefSeq Acc Id:

XM_039085106 ⟹ XP_038941034

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	42,321,695 - 42,468,087 (+)	NCBI
mRatBN7.2	10	41,821,220 - 41,967,618 (+)	NCBI

RefSeq Acc Id:

XM_039085107 ⟹ XP_038941035

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	42,321,691 - 42,455,384 (+)	NCBI
mRatBN7.2	10	41,821,216 - 41,955,362 (+)	NCBI

RefSeq Acc Id:

XM_039085109 ⟹ XP_038941037

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	42,321,691 - 42,453,821 (+)	NCBI
mRatBN7.2	10	41,821,216 - 41,953,165 (+)	NCBI

RefSeq Acc Id:

XM_039085110 ⟹ XP_038941038

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	42,321,693 - 42,453,821 (+)	NCBI
mRatBN7.2	10	41,821,217 - 41,953,165 (+)	NCBI

RefSeq Acc Id:

XM_063268357 ⟹ XP_063124427

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	42,321,701 - 42,453,821 (+)	NCBI

RefSeq Acc Id:

XM_063268358 ⟹ XP_063124428

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	42,321,703 - 42,453,821 (+)	NCBI

RefSeq Acc Id:

XR_010055122

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	42,321,691 - 42,458,941 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_570098	(Get FASTA)	NCBI Sequence Viewer
	XP_038941033	(Get FASTA)	NCBI Sequence Viewer
	XP_038941034	(Get FASTA)	NCBI Sequence Viewer
	XP_038941035	(Get FASTA)	NCBI Sequence Viewer
	XP_038941037	(Get FASTA)	NCBI Sequence Viewer
	XP_038941038	(Get FASTA)	NCBI Sequence Viewer
	XP_063124427	(Get FASTA)	NCBI Sequence Viewer
	XP_063124428	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK54498	(Get FASTA)	NCBI Sequence Viewer
	EDM04502	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000103640
GenBank Protein	Q925R7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_570098 ⟸ NM_130742

- UniProtKB:

Q925R7 (UniProtKB/Swiss-Prot), A6HEP7 (UniProtKB/TrEMBL), A0A8L2Q1N1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRRKEKRLLQAVALALAALVLLPNVGLWALYRERQPDGSPGGSGAAVAPEAIQELHSRQKKTLF
LGAEQRLKDWHNKEAIRRDAQRVGNGEQGKPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLP
DIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHL
KKPLEDYMALFPSVRILRTKKREGLIRTRMLGASAATGDVITFLDSHCEANVNWLPPLLDRIAR
NRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGG
LFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGV
SLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLRGSLNCKSFKWFMTKIAWDLPK
FYPPVEPPAAAWGEIRNVGTGLCTDTKHGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIR
PGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMN
TCNPSSLTQQWLFEHTNSTVLENFNRN

hide sequence

Ensembl Acc Id:

ENSRNOP00000003447 ⟸ ENSRNOT00000003447

RefSeq Acc Id:	XP_038941035 ⟸ XM_039085107
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038941037 ⟸ XM_039085109
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038941038 ⟸ XM_039085110
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038941034 ⟸ XM_039085106
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2Q1N1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941033 ⟸ XM_039085105
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q1N1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063124427 ⟸ XM_063268357
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063124428 ⟸ XM_063268358
- Peptide Label:	isoform X7

Ensembl Acc Id:

ENSRNOP00000103640 ⟸ ENSRNOT00000131733

Ensembl Acc Id:

ENSRNOP00000107987 ⟸ ENSRNOT00000134414

Protein Domains

Ricin B lectin Ricin B-type lectin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q925R7-F1-model_v2	AlphaFold	Q925R7	1-603	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697206

Promoter ID:

EPDNEW_R7730

Type:

initiation region

Name:

Galnt10_1

Description:

polypeptide N-acetylgalactosaminyltransferase 10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	43,067,199 - 43,067,259	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69409	AgrOrtholog
BioCyc Gene	G2FUF-25017	BioCyc
Ensembl Genes	ENSRNOG00000002488	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000131733	ENTREZGENE
Gene3D-CATH	2.80.10.50	UniProtKB/Swiss-Prot
	Spore Coat Polysaccharide Biosynthesis Protein SpsA, Chain A	UniProtKB/Swiss-Prot
InterPro	GalNAc-T	UniProtKB/Swiss-Prot
	Glyco_trans_2-like	UniProtKB/Swiss-Prot
	Nucleotide-diphossugar_trans	UniProtKB/Swiss-Prot
	Ricin_B-like_lectins	UniProtKB/Swiss-Prot
	Ricin_B_lectin	UniProtKB/Swiss-Prot
KEGG Report	rno:170501	UniProtKB/Swiss-Prot
NCBI Gene	170501	ENTREZGENE
PANTHER	N-ACETYLGALACTOSAMINYLTRANSFERASE	UniProtKB/Swiss-Prot
	POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 10	UniProtKB/Swiss-Prot
Pfam	Glycos_transf_2	UniProtKB/Swiss-Prot
	Ricin_B_lectin	UniProtKB/Swiss-Prot
PhenoGen	Galnt10	PhenoGen
PROSITE	RICIN_B_LECTIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002488	RatGTEx
SMART	RICIN	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50370	UniProtKB/Swiss-Prot
	SSF53448	UniProtKB/Swiss-Prot
TIGR	TC207700
UniProt	A0A8L2Q1N1	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LBN6_RAT	UniProtKB/TrEMBL
	A0ABK0LDU9_RAT	UniProtKB/TrEMBL
	A6HEP7	ENTREZGENE, UniProtKB/TrEMBL
	GLT10_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Galnt10	polypeptide N-acetylgalactosaminyltransferase 10	LOC103693329	uncharacterized LOC103693329	Data merged from RGD:9313909	737654	PROVISIONAL
2014-08-25	LOC103693329	uncharacterized LOC103693329			Symbol and Name status set to provisional	70820	PROVISIONAL
2014-03-21	Galnt10	polypeptide N-acetylgalactosaminyltransferase 10	Galnt10	UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-17	Galnt10	UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)	Galnt10	UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-11-08	Galnt10	UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase 10	Galnt9	UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase 9	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED
2002-06-10	Galnt9	UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 9			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in sublingual gland, testis, small intestine, colon, and ovary, with lesser amounts in heart, brain, spleen, lung, stomach, cervix, and uterus	68708
gene_function	catalyze the transfer of GalNAc from the nucleotide sugar UDP-GalNAc to the hydroxyl group of either serine or threonine	68708

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)