Zfp354c (zinc finger protein 354C)

Advanced Search (OLGA)

Gene: Zfp354c (zinc finger protein 354C) Rattus norvegicus

Analyze

Symbol:

Zfp354c

Name:

zinc finger protein 354C

RGD ID:

69405

Description:

Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in negative regulation of sprouting angiogenesis and regulation of transcription by RNA polymerase II. Predicted to be located in cytoplasm; nuclear membrane; and nucleoplasm. Predicted to be active in nucleus. Orthologous to human ZNF354C (zinc finger protein 354C); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AJ18; NOT NULL; Zfn354c; zinc finger transcription factor; Znf354c

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZNF354C (zinc finger protein 354C)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Zfp354c (zinc finger protein 354C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Znf354c (zinc finger protein 354C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZNF354C (zinc finger protein 354C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZNF354C (zinc finger protein 354C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Znf354c (zinc finger protein 354C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Zfp354c (zinc finger protein 354C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ZNF354C (zinc finger protein 354C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ZAP1	Alliance	DIOPT (Hieranoid\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	35,630,738 - 35,647,176 (-)	NCBI		GRCr8
mRatBN7.2	10	35,129,720 - 35,145,717 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	35,132,959 - 35,145,661 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	39,815,883 - 39,826,902 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	8,355,135 - 8,366,154 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	34,809,549 - 34,820,568 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	36,311,343 - 36,322,356 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	36,307,670 - 36,323,055 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	36,078,674 - 36,094,684 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	36,387,210 - 36,398,223 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	36,388,258 - 36,399,272 (-)	NCBI
Celera	10	34,492,608 - 34,503,621 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Ehlers-Danlos syndrome dermatosparaxis type (ISO)

frontotemporal dementia and/or amyotrophic lateral sclerosis 1 (ISO)

Sotos syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

ammonium chloride (EXP)

aripiprazole (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

carbon nanotube (ISO)

choline (ISO)

deoxynivalenol (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

endosulfan (EXP)

flavonoids (EXP)

folic acid (ISO)

gentamycin (EXP)

hydralazine (ISO)

L-methionine (ISO)

methimazole (EXP)

methotrexate (ISO)

miconazole (ISO)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

pioglitazone (ISO)

poly(I:C) (EXP)

sodium arsenite (ISO)

sunitinib (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (IEA)

negative regulation of sprouting angiogenesis (IEA,ISO,ISS)

negative regulation of transcription by RNA polymerase II (IEA)

regulation of transcription by RNA polymerase II (IBA)

Cellular Component

cytoplasm (IEA,ISO,ISS)

nuclear membrane (IEA,ISO,ISS)

nucleoplasm (IEA,ISO)

nucleus (IBA,ISO,ISS)

Molecular Function

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO,ISS)

metal ion binding (IEA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Characterization of a novel KRAB/C2H2 zinc finger transcription factor involved in bone development.	Jheon AH, etal., J Biol Chem 2001 May 25;276(21):18282-9.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:12070276	PMID:22009963

Genomics

Comparative Map Data

Zfp354c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	35,630,738 - 35,647,176 (-)	NCBI		GRCr8
mRatBN7.2	10	35,129,720 - 35,145,717 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	35,132,959 - 35,145,661 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	39,815,883 - 39,826,902 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	8,355,135 - 8,366,154 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	34,809,549 - 34,820,568 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	36,311,343 - 36,322,356 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	36,307,670 - 36,323,055 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	36,078,674 - 36,094,684 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	36,387,210 - 36,398,223 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	36,388,258 - 36,399,272 (-)	NCBI
Celera	10	34,492,608 - 34,503,621 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

ZNF354C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	179,060,373 - 179,083,977 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	179,060,373 - 179,083,977 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	178,487,374 - 178,510,978 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	178,420,213 - 178,440,301 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	178,420,212 - 178,440,295	NCBI
Celera	5	174,114,833 - 174,134,921 (+)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	173,215,131 - 173,235,219 (+)	NCBI		HuRef
CHM1_1	5	177,920,809 - 177,940,927 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	179,613,560 - 179,637,167 (+)	NCBI		T2T-CHM13v2.0

Zfp354c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	50,701,912 - 50,718,558 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	50,701,913 - 50,718,551 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	50,811,085 - 50,827,731 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	50,811,086 - 50,827,724 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	50,624,587 - 50,641,233 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	50,654,789 - 50,671,154 (-)	NCBI		MGSCv36	mm8
Celera	11	55,373,192 - 55,389,837 (-)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	30.93	NCBI

Znf354c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955417	2,853,263 - 2,854,930 (+)	NCBI	ChiLan1.0	ChiLan1.0

ZNF354C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	174,003,937 - 174,030,148 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	172,143,498 - 172,169,688 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	174,221,135 - 174,247,281 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	181,512,177 - 181,535,139 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	181,512,177 - 181,535,130 (+)	Ensembl	panpan1.1		panPan2

ZNF354C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	80,811,135 - 80,832,331 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	80,810,931 - 80,828,920 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	12,166,403 - 12,190,812 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Znf354c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624733	42,018,395 - 42,056,783 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Zfp354c
108 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	23
Count of miRNA genes:	21
Interacting mature miRNAs:	23
Transcripts:	ENSRNOT00000000248
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
631531	Iresp2	Immunoglobin response QTL2	6.3		blood immunoglobulin E amount (VT:0002492)	serum immunoglobulin E level (CMO:0002101)	10	22918268	36400810	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Markers in Region

BF404238

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	35,133,145 - 35,133,300 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	36,311,100 - 36,311,254	NCBI	Rnor6.0
Rnor_5.0	10	36,082,101 - 36,082,255	UniSTS	Rnor5.0
RGSC_v3.4	10	36,386,967 - 36,387,121	UniSTS	RGSC3.4
Celera	10	34,492,365 - 34,492,519	UniSTS
RH 3.4 Map	10	368.5	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_023988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC115666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF321874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF445643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000248 ⟹ ENSRNOP00000000248

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	35,132,959 - 35,145,661 (-)	Ensembl
Rnor_6.0 Ensembl	10	36,311,343 - 36,322,356 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000081026 ⟹ ENSRNOP00000075122

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	36,307,670 - 36,323,055 (-)	Ensembl

RefSeq Acc Id:

NM_023988 ⟹ NP_076478

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,630,738 - 35,646,691 (-)	NCBI
mRatBN7.2	10	35,129,720 - 35,145,673 (-)	NCBI
Rnor_6.0	10	36,311,343 - 36,322,356 (-)	NCBI
Rnor_5.0	10	36,078,674 - 36,094,684 (-)	NCBI
RGSC_v3.4	10	36,387,210 - 36,398,223 (-)	RGD
Celera	10	34,492,608 - 34,503,621 (-)	RGD

Sequence:

show sequence

ATGGCTGTGGATTTGCTGGCTGCTCGAGGGACGGAGCCTGTGACGTTCAGGGACGTCGCTGTGT
CCTTCAGCCAGGATGAGTGGCTGCATCTGGACCCTGCTCAGAGAACCCTGTACCGAGAGGTGAT
GCTGGAGAACTACAGCAACCTGGCCTCGCTGGGGTTTCAGGCTTCCATACCTCCCGTGATTGGC
AAGCTGCAGAAAGGGCAAGACCCTTGCATGGAAAGAGAAGCCCCGGAAGACACCTGCCTAGATT
TCCAGATTCAGTCGGAGATAGAAGCGTCGTCCCCTGAACAAGACGTTTTTATTGAAGGACCATC
TCGTGGGCTGCTAAAGAACAGATCTACTAAGTGTGCTTACTGGAAAATCAGCTTTGGAGAGCTT
GTGAAATATGAGAGGCTAGAGACAGCACAGGAGCAAGAAAAGAAAGCTCACGAGCCAGGGGCAG
CTTCCCCCAAGGAAGTCACCAGTGAAGATGGAATTCCCACAGACCCTGAGCTCGAGAAGCCCTT
GTTCATGAATAAAGCACTAGTTTCACAAGAGACCGATCCCATAGAAAGGGTCCCTGGTATGTAT
CACACTTCAGAGAAAGATTTACCACAGGATTTTGATTTAATGAGAAACTTTCAGATTTATCCGG
GACAAAAACCTTATGTCTGCAGTGAATGTGGGAAGGGTTTTAGCCAAAGTCTTCATCTTCTAGA
GCACAAGAGGATTCACACTGGGGAGAAACCTTACAAATGCAGTGAGTGTGGCAAAAGCTTCAGC
CATAGATCTTCCCTCCTGGCTCACCAGAGAACCCACACCGGAGAGAAGCCGTACAAATGTAGTG
AGTGTGAGAAAGCCTTCGGCAGCAGCTCCACACTCATCAAACACCTGAGGGTGCACACCGGAGA
GAAACCTTACCGCTGCCGGGAATGTGGGAAGGCCTTCAGCCAGTGTTCAACCCTCACTGTGCAC
CAGAGGATTCACACTGGGGAAAAGCTCTACAAATGTGCTGAGTGTGACAAAGCCTTCAACTGCA
GAGCAAAGCTCCACAGACATCAGAGGATCCACACGGGTGAGAAACCTTATAAATGTGCTGAGTG
TGGGAAAGGATACAGCCAGTTCCCATCCCTGGCTGAGCATCAGAGACTCCATACTGGAGGACAG
CTTTGCCAGTGCTTACAGTGTGGGAGAACCTTTACACGTGTGTCTACCCTTATCGAACACCAGA
GAATTCATACTGGACAGAAACCATATCAATGCAACGAATGTGGGAAGACCTTCAACCAGTATTC
CTCCTTCAACGAACATCGGAAGATTCACACTGGGGAGAAACTTTACACATGTGAAGAATGTGGG
AAAGCCTTTGGCTGTAAATCAAACCTTTATCGGCATCAGAGGATCCATACTGGTGAGAAACCCT
ATCAGTGTAATCAGTGTGGCAAGGCCTTCAGCCAGTATTCATTCCTAACGGAACACGAGCGAAT
CCATACTGGAGAGAAGCTCTACAAGTGTATGGAGTGTGGGAAAGCCTATAGTTACAGGTCAAAC
CTCTGTAGACACAAGAAAGTCCACCTGAAAGAAAGGCTCTATAAATGGAAAGAATACGGCACAC
CTTTCATGTACGGCTCATCCCTCGCTCCACATCAGAGGTGTCTGAAGGGGGAGAAGCCTGAGGA
CCTTAATTCATCCCTCTGA

hide sequence

RefSeq Acc Id:

XM_039086906 ⟹ XP_038942834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	35,630,738 - 35,647,176 (-)	NCBI
mRatBN7.2	10	35,129,720 - 35,145,717 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_076478	(Get FASTA)	NCBI Sequence Viewer
	XP_038942834	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG41994	(Get FASTA)	NCBI Sequence Viewer
	AAL57512	(Get FASTA)	NCBI Sequence Viewer
	EDM04281	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000248.1
GenBank Protein	Q9EPU7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_076478 ⟸ NM_023988

- UniProtKB:

A6HE26 (UniProtKB/TrEMBL), G3V609 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAVDLLAARGTEPVTFRDVAVSFSQDEWLHLDPAQRTLYREVMLENYSNLASLGFQASIPPVIG
KLQKGQDPCMEREAPEDTCLDFQIQSEIEASSPEQDVFIEGPSRGLLKNRSTKCAYWKISFGEL
VKYERLETAQEQEKKAHEPGAASPKEVTSEDGIPTDPELEKPLFMNKALVSQETDPIERVPGMY
HTSEKDLPQDFDLMRNFQIYPGQKPYVCSECGKGFSQSLHLLEHKRIHTGEKPYKCSECGKSFS
HRSSLLAHQRTHTGEKPYKCSECEKAFGSSSTLIKHLRVHTGEKPYRCRECGKAFSQCSTLTVH
QRIHTGEKLYKCAECDKAFNCRAKLHRHQRIHTGEKPYKCAECGKGYSQFPSLAEHQRLHTGGQ
LCQCLQCGRTFTRVSTLIEHQRIHTGQKPYQCNECGKTFNQYSSFNEHRKIHTGEKLYTCEECG
KAFGCKSNLYRHQRIHTGEKPYQCNQCGKAFSQYSFLTEHERIHTGEKLYKCMECGKAYSYRSN
LCRHKKVHLKERLYKWKEYGTPFMYGSSLAPHQRCLKGEKPEDLNSSL

hide sequence

Ensembl Acc Id:

ENSRNOP00000000248 ⟸ ENSRNOT00000000248

Ensembl Acc Id:

ENSRNOP00000075122 ⟸ ENSRNOT00000081026

RefSeq Acc Id:	XP_038942834 ⟸ XM_039086906
- Peptide Label:	isoform X1
- UniProtKB:	A6HE26 (UniProtKB/TrEMBL), G3V609 (UniProtKB/TrEMBL)

Protein Domains

C2H2-type KRAB

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EPU7-F1-model_v2	AlphaFold	Q9EPU7	1-560	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69405	AgrOrtholog
BioCyc Gene	G2FUF-25229	BioCyc
Ensembl Genes	ENSRNOG00000029205	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000248.3	UniProtKB/TrEMBL
Gene3D-CATH	6.10.140.140	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Classic Zinc Finger	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GLI_C2H2-zinc-finger	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	KRAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	KRAB_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_C2H2_type	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:78972	UniProtKB/Swiss-Prot
NCBI Gene	Zfp354c	ENTREZGENE
PANTHER	C2H2-TYPE DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot
	ZINC FINGER PROTEIN 728-LIKE	UniProtKB/TrEMBL
	ZINC FINGER PROTEIN ZIC AND GLI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	KRAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	zf-C2H2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	zf-H2C2_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Zfp354c	PhenoGen
PROSITE	KRAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000029205	RatGTEx
SMART	KRAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZnF_C2H2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF109640	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57667	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC212161
UniProt	A6HE26	ENTREZGENE, UniProtKB/TrEMBL
	G3V609	ENTREZGENE, UniProtKB/TrEMBL
	Q9EPU7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Description	Reference	Status
2006-03-30	Zfp354c	zinc finger protein 354C	Znf354c	Symbol updated	1299863	APPROVED
2002-06-10	Znf354c	zinc finger protein 354C		Symbol and Name status set to approved	70586	APPROVED
2002-01-14	Znf354c	zinc finger protein 354C		Correction to the spelling of the symbol	69665	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains a Kruppel-associated box (KRAB) domain followed by 11 successive acetylene-zinc finger motifs	68678
gene_expression	developmentally regulated in embryonic tibiae and calvariae, little expression in neonate and adult	68678
gene_expression	expressed in kidney and brain	68678
gene_expression	produced by Sertoli cells of testis and ovarian granulosa cells until menopause	68678
gene_function	zinc finger transcription factor	68678
gene_process	may function as an endogenous hormonal regulator of NFkB signaling and growth in the mammalian breast	68678
gene_process	modulates Runx2 activity and osteogenic differentiation	68678
gene_protein	64-kDa protein	68678
gene_transcript	7-kb mRNA	68678

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar