Symbol:
Htra1
Name:
HtrA serine peptidase 1
RGD ID:
69235
Description:
Predicted to enable identical protein binding activity; molecular function activator activity; and serine-type endopeptidase activity. Involved in dentinogenesis; negative regulation of defense response to virus; and positive regulation of epithelial cell proliferation. Located in collagen-containing extracellular matrix. Human ortholog(s) of this gene implicated in CADASIL (multiple); gastrointestinal system cancer (multiple); hypertension; lung adenocarcinoma; and macular degeneration (multiple). Orthologous to human HTRA1 (HtrA serine peptidase 1); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
high-temperature requirement A serine peptidase 1; MGC93339; protease serine 11; protease serine 11 (Igf binding); protease, serine, 11; protease, serine, 11 (Igf binding); Prss11; serine protease 11; serine protease HTRA1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HTRA1 (HtrA serine peptidase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Htra1 (HtrA serine peptidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Htra1 (HtrA serine peptidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HTRA1 (HtrA serine peptidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HTRA1 (HtrA serine peptidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Htra1 (HtrA serine peptidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HTRA1 (HtrA serine peptidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HTRA1 (HtrA serine peptidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Htra1 (HtrA serine peptidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HTRA3 (HtrA serine peptidase 3) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
HTRA1 (HtrA serine peptidase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Htra1 (HtrA serine peptidase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
htra1a (HtrA serine peptidase 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
htra1b (HtrA serine peptidase 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
NMA111
Alliance
DIOPT (Ensembl Compara|OrthoInspector)
Drosophila melanogaster (fruit fly):
HtrA2
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
htra1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 194,928,069 - 194,977,619 (+) NCBI GRCr8 mRatBN7.2 1 185,497,815 - 185,547,380 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 185,497,735 - 185,547,379 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 193,848,030 - 193,897,573 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 201,026,602 - 201,075,741 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 193,698,377 - 193,747,515 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 201,499,067 - 201,548,508 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 201,499,028 - 201,548,513 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 208,532,013 - 208,581,538 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 190,257,899 - 190,308,325 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 190,407,779 - 190,458,206 (+) NCBI Celera 1 183,110,143 - 183,159,496 (+) NCBI Celera Cytogenetic Map 1 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Htra1 Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane affects expression EXP 6480464 2 more ... CTD PMID:19414516 Htra1 Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Htra1 Rat 1,2-dimethylhydrazine multiple interactions ISO Htra1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of HTRA1 mRNA] CTD PMID:22206623 Htra1 Rat 1,2-dimethylhydrazine increases expression ISO Htra1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of HTRA1 mRNA CTD PMID:22206623 Htra1 Rat 17alpha-ethynylestradiol multiple interactions ISO Htra1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HTRA1 mRNA CTD PMID:17942748 Htra1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO HTRA1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Htra1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Htra1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Htra1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Htra1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HTRA1 mRNA CTD PMID:17942748 Htra1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HTRA1 mRNA CTD PMID:33387578 Htra1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HTRA1 mRNA CTD PMID:34747641 Htra1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Htra1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HTRA1 mRNA CTD PMID:26290441 Htra1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Htra1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HTRA1 mRNA CTD PMID:21570461 and PMID:26377647 Htra1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HTRA1 mRNA CTD PMID:21215274 and PMID:32109520 Htra1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Htra1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Htra1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of HTRA1 mRNA CTD PMID:21346803 Htra1 Rat 3',5'-cyclic AMP multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Htra1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of HTRA1 mRNA CTD PMID:28522335 Htra1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Htra1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of HTRA1 mRNA CTD PMID:30951980 Htra1 Rat 4,4'-sulfonyldiphenol increases expression ISO HTRA1 (Homo sapiens) 6480464 bisphenol S results in increased expression of HTRA1 protein CTD PMID:34186270 Htra1 Rat 4,4'-sulfonyldiphenol increases expression ISO Htra1 (Mus musculus) 6480464 bisphenol S results in increased expression of HTRA1 mRNA CTD PMID:30951980 Htra1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Htra1 (Mus musculus) 6480464 Fenretinide results in decreased expression of HTRA1 mRNA CTD PMID:28973697 Htra1 Rat 5-aza-2'-deoxycytidine increases expression ISO HTRA1 (Homo sapiens) 6480464 Decitabine results in increased expression of HTRA1 mRNA CTD PMID:36861143 Htra1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO HTRA1 (Homo sapiens) 6480464 Arsenic inhibits the reaction [Decitabine results in increased expression of HTRA1 mRNA] CTD PMID:36861143 Htra1 Rat 5-fluorouracil increases expression ISO HTRA1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of HTRA1 protein CTD PMID:15352031 Htra1 Rat 5-fluorouracil affects response to substance ISO HTRA1 (Homo sapiens) 6480464 HTRA1 protein affects the susceptibility to Fluorouracil CTD PMID:15352031 Htra1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of HTRA1 mRNA CTD PMID:19483382 Htra1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of HTRA1 mRNA CTD PMID:19483382 Htra1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of HTRA1 mRNA CTD PMID:30047161 Htra1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of HTRA1 mRNA CTD PMID:24780913 Htra1 Rat acetazolamide increases expression ISO Htra1 (Mus musculus) 6480464 Acetazolamide results in increased expression of HTRA1 mRNA CTD PMID:19274763 Htra1 Rat acrylamide increases expression ISO Htra1 (Mus musculus) 6480464 Acrylamide results in increased expression of HTRA1 mRNA CTD PMID:30807115 Htra1 Rat acrylamide decreases expression ISO HTRA1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of HTRA1 mRNA CTD PMID:32763439 Htra1 Rat actinomycin D multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of HTRA1 protein CTD PMID:38460933 Htra1 Rat all-trans-retinoic acid multiple interactions ISO Htra1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of HTRA1 mRNA and [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of HTRA1 mRNA CTD PMID:30951980 and PMID:36189433 Htra1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of HTRA1 mRNA CTD PMID:19483382 Htra1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of HTRA1 mRNA CTD PMID:30047161 Htra1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HTRA1 mRNA CTD PMID:16483693 Htra1 Rat antimycin A increases expression ISO Htra1 (Mus musculus) 6480464 Antimycin A results in increased expression of HTRA1 mRNA CTD PMID:19304788 Htra1 Rat aristolochic acid A decreases expression ISO HTRA1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of HTRA1 mRNA CTD PMID:33212167 Htra1 Rat Aroclor 1254 affects expression ISO HTRA1 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) affects the expression of HTRA1 mRNA CTD PMID:17851650 Htra1 Rat arsane decreases expression ISO HTRA1 (Homo sapiens) 6480464 Arsenic results in decreased expression of HTRA1 mRNA and Arsenic results in decreased expression of HTRA1 protein CTD PMID:36861143 Htra1 Rat arsane multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [Arsenic co-treated with WT161] results in increased expression of HTRA1 mRNA more ... CTD PMID:36861143 Htra1 Rat arsenic atom decreases expression ISO HTRA1 (Homo sapiens) 6480464 Arsenic results in decreased expression of HTRA1 mRNA and Arsenic results in decreased expression of HTRA1 protein CTD PMID:36861143 Htra1 Rat arsenic atom multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [Arsenic co-treated with WT161] results in increased expression of HTRA1 mRNA more ... CTD PMID:36861143 Htra1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of HTRA1 mRNA CTD PMID:19483382 Htra1 Rat benzo[a]pyrene increases expression ISO Htra1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of HTRA1 mRNA CTD PMID:20713471 Htra1 Rat benzo[a]pyrene decreases methylation ISO HTRA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of HTRA1 promoter CTD PMID:27901495 Htra1 Rat beta-naphthoflavone decreases expression ISO HTRA1 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of HTRA1 mRNA CTD PMID:32858204 Htra1 Rat bis(2-chloroethyl) sulfide decreases expression ISO HTRA1 (Homo sapiens) 6480464 Mustard Gas results in decreased expression of HTRA1 mRNA CTD PMID:25102026 Htra1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Htra1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of HTRA1 mRNA CTD PMID:39150890 Htra1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Htra1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of HTRA1 mRNA CTD PMID:33754040 Htra1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HTRA1 mRNA CTD PMID:25181051 and PMID:29097150 Htra1 Rat bisphenol A decreases expression ISO HTRA1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HTRA1 protein CTD PMID:33376534 Htra1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HTRA1 mRNA CTD PMID:34947998 Htra1 Rat bisphenol A increases expression ISO HTRA1 (Homo sapiens) 6480464 bisphenol A results in increased expression of HTRA1 mRNA CTD PMID:29718440 Htra1 Rat bisphenol A increases expression ISO Htra1 (Mus musculus) 6480464 bisphenol A results in increased expression of HTRA1 mRNA CTD PMID:30951980 Htra1 Rat Bisphenol B increases expression ISO HTRA1 (Homo sapiens) 6480464 bisphenol B results in increased expression of HTRA1 protein CTD PMID:34186270 Htra1 Rat bisphenol F increases expression ISO Htra1 (Mus musculus) 6480464 bisphenol F results in increased expression of HTRA1 mRNA CTD PMID:30951980 and PMID:38685157 Htra1 Rat bisphenol F increases expression ISO HTRA1 (Homo sapiens) 6480464 bisphenol F results in increased expression of HTRA1 protein CTD PMID:34186270 Htra1 Rat Butylbenzyl phthalate multiple interactions ISO Htra1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of HTRA1 mRNA CTD PMID:39150890 Htra1 Rat cadmium atom decreases expression ISO HTRA1 (Homo sapiens) 6480464 Cadmium results in decreased expression of HTRA1 mRNA CTD PMID:23369406 Htra1 Rat cadmium dichloride decreases expression ISO HTRA1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of HTRA1 mRNA CTD PMID:30998937 Htra1 Rat calcium dichloride decreases expression ISO HTRA1 (Homo sapiens) 6480464 Calcium Chloride results in decreased expression of HTRA1 protein CTD PMID:25824407 Htra1 Rat captan decreases expression ISO Htra1 (Mus musculus) 6480464 Captan results in decreased expression of HTRA1 mRNA CTD PMID:31558096 Htra1 Rat carbon nanotube affects expression ISO Htra1 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of HTRA1 mRNA CTD PMID:25554681 Htra1 Rat carbon nanotube increases expression ISO HTRA1 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of HTRA1 mRNA CTD PMID:29906516 Htra1 Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of HTRA1 mRNA CTD PMID:19395590 Htra1 Rat chloropicrin decreases expression ISO HTRA1 (Homo sapiens) 6480464 chloropicrin results in decreased expression of HTRA1 mRNA CTD PMID:28476498 Htra1 Rat chloropicrin affects expression ISO HTRA1 (Homo sapiens) 6480464 chloropicrin affects the expression of HTRA1 mRNA CTD PMID:26352163 Htra1 Rat chromium(6+) multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of HTRA1 mRNA CTD PMID:38479592 Htra1 Rat ciguatoxin CTX1B affects expression ISO Htra1 (Mus musculus) 6480464 Ciguatoxins affects the expression of HTRA1 mRNA CTD PMID:18353800 Htra1 Rat cisplatin affects expression ISO HTRA1 (Homo sapiens) 152977759 cisplatin affects expression of HTRA1 mRNA in colonic epithelium RGD Htra1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of HTRA1 mRNA CTD PMID:19483382 Htra1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of HTRA1 mRNA CTD PMID:17602206 Htra1 Rat cobalt dichloride decreases expression ISO HTRA1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of HTRA1 mRNA CTD PMID:19320972 Htra1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of HTRA1 mRNA CTD PMID:24386269 Htra1 Rat copper atom multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of HTRA1 mRNA CTD PMID:20971185 Htra1 Rat copper(0) multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of HTRA1 mRNA CTD PMID:20971185 Htra1 Rat copper(II) sulfate decreases expression ISO HTRA1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of HTRA1 mRNA CTD PMID:19549813 Htra1 Rat corosolic acid increases expression ISO HTRA1 (Homo sapiens) 6480464 corosolic acid results in increased expression of HTRA1 mRNA CTD PMID:37939859 Htra1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of HTRA1 mRNA CTD PMID:26577399 Htra1 Rat cyclosporin A decreases expression ISO HTRA1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HTRA1 mRNA CTD PMID:27989131 Htra1 Rat cytarabine decreases expression ISO HTRA1 (Homo sapiens) 6480464 Cytarabine results in decreased expression of HTRA1 mRNA CTD PMID:21198554 Htra1 Rat deoxycholic acid affects response to substance ISO HTRA1 (Homo sapiens) 6480464 HTRA1 protein affects the susceptibility to Deoxycholic Acid CTD PMID:12507930 Htra1 Rat dextran sulfate decreases expression ISO Htra1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of HTRA1 mRNA CTD PMID:35093514 Htra1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of HTRA1 mRNA CTD PMID:24893172 Htra1 Rat dibutyl phthalate multiple interactions ISO Htra1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of HTRA1 mRNA CTD PMID:39150890 Htra1 Rat diethyl phthalate multiple interactions ISO Htra1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of HTRA1 mRNA CTD PMID:39150890 Htra1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of HTRA1 mRNA CTD PMID:17005392 Htra1 Rat diisobutyl phthalate multiple interactions ISO Htra1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of HTRA1 mRNA CTD PMID:39150890 Htra1 Rat diisononyl phthalate multiple interactions ISO Htra1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of HTRA1 mRNA CTD PMID:39150890 Htra1 Rat dimethylarsinous acid decreases expression ISO HTRA1 (Homo sapiens) 6480464 dimethylarsinous acid results in decreased expression of HTRA1 mRNA CTD PMID:23487506 Htra1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of HTRA1 mRNA CTD PMID:25152437 Htra1 Rat dorsomorphin multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Htra1 Rat doxorubicin affects response to substance ISO HTRA1 (Homo sapiens) 6480464 HTRA1 mRNA affects the susceptibility to Doxorubicin CTD PMID:16243817 Htra1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of HTRA1 mRNA CTD PMID:29391264 Htra1 Rat ethanol increases expression ISO Htra1 (Mus musculus) 6480464 Ethanol results in increased expression of HTRA1 mRNA CTD PMID:30319688 Htra1 Rat ethanol affects expression ISO Htra1 (Mus musculus) 6480464 Ethanol affects the expression of HTRA1 mRNA CTD PMID:30319688 Htra1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of HTRA1 mRNA CTD PMID:24136188 Htra1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of HTRA1 mRNA CTD PMID:24793618 Htra1 Rat folic acid multiple interactions ISO Htra1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of HTRA1 mRNA] CTD PMID:22206623 Htra1 Rat folpet decreases expression ISO Htra1 (Mus musculus) 6480464 folpet results in decreased expression of HTRA1 mRNA CTD PMID:31558096 Htra1 Rat fonofos increases methylation ISO HTRA1 (Homo sapiens) 6480464 Fonofos results in increased methylation of HTRA1 promoter CTD PMID:22847954 Htra1 Rat formaldehyde increases expression ISO HTRA1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of HTRA1 mRNA CTD PMID:28937961 Htra1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of HTRA1 mRNA CTD PMID:25539665 Htra1 Rat gefitinib multiple interactions ISO HTRA1 (Homo sapiens) 6480464 Arsenic inhibits the reaction [Gefitinib results in increased expression of HTRA1 mRNA] CTD PMID:36861143 Htra1 Rat gefitinib increases expression ISO HTRA1 (Homo sapiens) 6480464 Gefitinib results in increased expression of HTRA1 mRNA CTD PMID:36861143 Htra1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HTRA1 mRNA CTD PMID:33387578 Htra1 Rat graphene oxide increases expression ISO HTRA1 (Homo sapiens) 6480464 graphene oxide results in increased expression of HTRA1 protein CTD PMID:33219560 and PMID:33219581 Htra1 Rat graphite affects expression EXP 6480464 Graphite affects the expression of HTRA1 mRNA CTD PMID:29933104 Htra1 Rat isotretinoin increases expression ISO HTRA1 (Homo sapiens) 6480464 Isotretinoin results in increased expression of HTRA1 mRNA CTD PMID:20436886 Htra1 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of HTRA1 mRNA CTD PMID:20080153 Htra1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of HTRA1 mRNA CTD PMID:19483382 Htra1 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of HTRA1 mRNA CTD PMID:28801915 Htra1 Rat mercury dibromide decreases expression ISO HTRA1 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of HTRA1 mRNA CTD PMID:26272509 Htra1 Rat mercury dibromide multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of HTRA1 mRNA CTD PMID:27188386 Htra1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of HTRA1 mRNA CTD PMID:30047161 Htra1 Rat methotrexate affects expression ISO Htra1 (Mus musculus) 6480464 Methotrexate affects the expression of HTRA1 mRNA CTD PMID:18502557 Htra1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of HTRA1 gene CTD PMID:35440735 Htra1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Htra1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of HTRA1 mRNA CTD PMID:36189433 Htra1 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of HTRA1 mRNA CTD PMID:19041683 Htra1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of HTRA1 mRNA CTD PMID:24136188 Htra1 Rat nickel atom decreases expression ISO HTRA1 (Homo sapiens) 6480464 Nickel results in decreased expression of HTRA1 mRNA CTD PMID:24768652 Htra1 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of HTRA1 mRNA CTD PMID:24136188 Htra1 Rat Nutlin-3 multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of HTRA1 protein CTD PMID:38460933 Htra1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of HTRA1 mRNA CTD PMID:19483382 Htra1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of HTRA1 mRNA CTD PMID:25729387 Htra1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of HTRA1 mRNA CTD PMID:25729387 Htra1 Rat p-chloromercuribenzoic acid decreases expression ISO HTRA1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of HTRA1 mRNA CTD PMID:26272509 Htra1 Rat p-chloromercuribenzoic acid multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of HTRA1 mRNA CTD PMID:27188386 Htra1 Rat paracetamol decreases expression ISO Htra1 (Mus musculus) 6480464 Acetaminophen results in decreased expression of HTRA1 mRNA CTD PMID:17585979 Htra1 Rat paracetamol decreases expression ISO HTRA1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of HTRA1 mRNA CTD PMID:21420995 Htra1 Rat parathion increases methylation ISO HTRA1 (Homo sapiens) 6480464 Parathion results in increased methylation of HTRA1 promoter CTD PMID:22847954 Htra1 Rat perfluorohexanesulfonic acid increases expression ISO Htra1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of HTRA1 mRNA CTD PMID:37995155 Htra1 Rat phenobarbital affects expression ISO HTRA1 (Homo sapiens) 6480464 Phenobarbital affects the expression of HTRA1 mRNA CTD PMID:19159669 Htra1 Rat phenylmercury acetate decreases expression ISO HTRA1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of HTRA1 mRNA CTD PMID:26272509 Htra1 Rat phenylmercury acetate multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of HTRA1 mRNA CTD PMID:27188386 Htra1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of HTRA1 mRNA CTD PMID:19483382 Htra1 Rat potassium chromate decreases expression ISO HTRA1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of HTRA1 mRNA CTD PMID:22714537 Htra1 Rat potassium dichromate increases expression ISO Htra1 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of HTRA1 mRNA CTD PMID:23608068 Htra1 Rat propiconazole decreases expression ISO Htra1 (Mus musculus) 6480464 propiconazole results in decreased expression of HTRA1 mRNA CTD PMID:21278054 Htra1 Rat rotenone increases expression ISO Htra1 (Mus musculus) 6480464 Rotenone results in increased expression of HTRA1 mRNA CTD PMID:19304788 Htra1 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO HTRA1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of HTRA1 mRNA CTD PMID:35811015 Htra1 Rat SB 431542 multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Htra1 Rat serpentine asbestos decreases methylation ISO HTRA1 (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased methylation of HTRA1 gene CTD PMID:29523930 Htra1 Rat silicon dioxide decreases expression ISO HTRA1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of HTRA1 mRNA CTD PMID:25895662 Htra1 Rat sodium arsenite decreases expression ISO HTRA1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HTRA1 mRNA CTD PMID:16507463 and PMID:38568856 Htra1 Rat sodium arsenite decreases expression ISO Htra1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of HTRA1 mRNA CTD PMID:37682722 Htra1 Rat sodium arsenite increases expression ISO HTRA1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HTRA1 mRNA CTD PMID:34032870 Htra1 Rat sotorasib multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of HTRA1 mRNA CTD PMID:36139627 Htra1 Rat sunitinib increases expression ISO HTRA1 (Homo sapiens) 6480464 Sunitinib results in increased expression of HTRA1 mRNA CTD PMID:31533062 Htra1 Rat tamoxifen increases expression ISO Htra1 (Mus musculus) 6480464 Tamoxifen results in increased expression of HTRA1 mRNA CTD PMID:25123088 Htra1 Rat temozolomide decreases expression ISO HTRA1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of HTRA1 mRNA CTD PMID:31758290 Htra1 Rat terbufos increases methylation ISO HTRA1 (Homo sapiens) 6480464 terbufos results in increased methylation of HTRA1 promoter CTD PMID:22847954 Htra1 Rat tert-butyl hydroperoxide decreases expression ISO HTRA1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of HTRA1 mRNA CTD PMID:15336504 Htra1 Rat testosterone increases expression ISO Htra1 (Mus musculus) 6480464 Testosterone results in increased expression of HTRA1 mRNA CTD PMID:15788153 Htra1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of HTRA1 mRNA CTD PMID:19483382 Htra1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of HTRA1 mRNA CTD PMID:34492290 Htra1 Rat thiram decreases expression ISO HTRA1 (Homo sapiens) 6480464 Thiram results in decreased expression of HTRA1 mRNA CTD PMID:38568856 Htra1 Rat thyroxine increases expression ISO Htra1 (Mus musculus) 6480464 Thyroxine results in increased expression of HTRA1 mRNA CTD PMID:23935926 Htra1 Rat tirbanibulin multiple interactions ISO HTRA1 (Homo sapiens) 6480464 Arsenic inhibits the reaction [tirbanibulin results in increased expression of HTRA1 mRNA] CTD PMID:36861143 Htra1 Rat tirbanibulin increases expression ISO HTRA1 (Homo sapiens) 6480464 tirbanibulin results in increased expression of HTRA1 mRNA CTD PMID:36861143 Htra1 Rat titanium dioxide decreases expression ISO Htra1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of HTRA1 mRNA CTD PMID:23557971 Htra1 Rat titanium dioxide increases methylation ISO Htra1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of HTRA1 gene CTD PMID:35295148 Htra1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of HTRA1 mRNA CTD PMID:25729387 Htra1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of HTRA1 mRNA CTD PMID:25729387 Htra1 Rat trametinib multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of HTRA1 mRNA CTD PMID:36139627 Htra1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of HTRA1 mRNA CTD PMID:17905399 Htra1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of HTRA1 mRNA CTD PMID:33387578 Htra1 Rat trichostatin A decreases expression ISO HTRA1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of HTRA1 mRNA CTD PMID:24935251 Htra1 Rat triclosan decreases expression ISO HTRA1 (Homo sapiens) 6480464 Triclosan results in decreased expression of HTRA1 mRNA CTD PMID:30510588 Htra1 Rat triptonide decreases expression ISO Htra1 (Mus musculus) 6480464 triptonide results in decreased expression of HTRA1 mRNA CTD PMID:33045310 Htra1 Rat tunicamycin increases expression ISO HTRA1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of HTRA1 mRNA CTD PMID:29453283 Htra1 Rat valproic acid increases expression ISO Htra1 (Mus musculus) 6480464 Valproic Acid results in increased expression of HTRA1 mRNA CTD PMID:19136453 Htra1 Rat valproic acid increases expression ISO HTRA1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HTRA1 mRNA CTD PMID:27188386 and PMID:28001369 Htra1 Rat valproic acid affects expression ISO HTRA1 (Homo sapiens) 6480464 Valproic Acid affects the expression of HTRA1 mRNA CTD PMID:25979313 Htra1 Rat valproic acid decreases expression ISO HTRA1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HTRA1 mRNA CTD PMID:23179753 Htra1 Rat vemurafenib multiple interactions ISO HTRA1 (Homo sapiens) 6480464 [(+)-JQ1 compound co-treated with vemurafenib] results in increased expression of HTRA1 protein CTD PMID:27169980 Htra1 Rat vitamin E increases expression ISO HTRA1 (Homo sapiens) 6480464 Vitamin E results in increased expression of HTRA1 mRNA CTD PMID:19244175 Htra1 Rat zoledronic acid decreases expression ISO HTRA1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of HTRA1 mRNA CTD PMID:24714768
1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 3',5'-cyclic AMP (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetazolamide (ISO) acrylamide (ISO) actinomycin D (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) antimycin A (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcium dichloride (ISO) captan (ISO) carbon nanotube (ISO) carbonyl sulfide (EXP) chloropicrin (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clofibrate (EXP) clofibric acid (EXP) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) Cuprizon (EXP) cyclosporin A (ISO) cytarabine (ISO) deoxycholic acid (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP,ISO) diethyl phthalate (ISO) diethylstilbestrol (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dimethylarsinous acid (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) fonofos (ISO) formaldehyde (ISO) furan (EXP) gefitinib (ISO) gentamycin (EXP) graphene oxide (ISO) graphite (EXP) isotretinoin (ISO) ketamine (EXP) L-ethionine (EXP) manganese(II) chloride (EXP) mercury dibromide (ISO) methimazole (EXP) methotrexate (ISO) methoxychlor (EXP) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) Nutlin-3 (ISO) omeprazole (EXP) oxaliplatin (EXP) p-chloromercuribenzoic acid (ISO) paracetamol (ISO) parathion (ISO) perfluorohexanesulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP) potassium chromate (ISO) potassium dichromate (ISO) propiconazole (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sotorasib (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) terbufos (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) thioacetamide (EXP) thiram (ISO) thyroxine (ISO) tirbanibulin (ISO) titanium dioxide (ISO) topotecan (EXP) trametinib (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) tunicamycin (ISO) valproic acid (ISO) vemurafenib (ISO) vitamin E (ISO) zoledronic acid (ISO)
1.
Low HtrA1 expression in patients with long‑standing ulcerative colitis and colorectal cancer.
Altobelli E, etal., Oncol Rep. 2017 Jul;38(1):418-426. doi: 10.3892/or.2017.5700. Epub 2017 Jun 6.
2.
Comprehensive analysis of complement factor H and LOC387715/ARMS2/HTRA1 variants with respect to phenotype in advanced age-related macular degeneration.
Andreoli MT, etal., Am J Ophthalmol. 2009 Dec;148(6):869-74. doi: 10.1016/j.ajo.2009.07.002. Epub 2009 Oct 1.
3.
The serine protease HtrA1 is a novel prognostic factor for human mesothelioma.
Baldi A, etal., Pharmacogenomics. 2008 Aug;9(8):1069-77. doi: 10.2217/14622416.9.8.1069.
4.
HTRA1 variant confers similar risks to geographic atrophy and neovascular age-related macular degeneration.
Cameron DJ, etal., Cell Cycle. 2007 May 2;6(9):1122-5. Epub 2007 May 16.
5.
HtrA1, a potential predictor of response to cisplatin-based combination chemotherapy in gastric cancer.
Catalano V, etal., Histopathology. 2011 Apr;58(5):669-78. doi: 10.1111/j.1365-2559.2011.03818.x. Epub 2011 Mar 30.
6.
Genetic and functional dissection of ARMS2 in age-related macular degeneration and polypoidal choroidal vasculopathy.
Cheng Y, etal., PLoS One. 2013;8(1):e53665. doi: 10.1371/journal.pone.0053665. Epub 2013 Jan 9.
7.
Alleles in the HtrA serine peptidase 1 gene alter the risk of neovascular age-related macular degeneration.
Deangelis MM, etal., Ophthalmology. 2008 Jul;115(7):1209-1215.e7. doi: 10.1016/j.ophtha.2007.10.032. Epub 2007 Dec 27.
8.
Identifying subtypes of patients with neovascular age-related macular degeneration by genotypic and cardiovascular risk characteristics.
Feehan M, etal., BMC Med Genet. 2011 Jun 17;12:83. doi: 10.1186/1471-2350-12-83.
9.
Joint effects of polymorphisms in the HTRA1, LOC387715/ARMS2, and CFH genes on AMD in a Caucasian population.
Francis PJ, etal., Mol Vis. 2008 Aug 4;14:1395-400.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Further mapping of 10q26 supports strong association of HTRA1 polymorphisms with age-related macular degeneration.
Gibbs D, etal., Vision Res. 2008 Feb;48(5):685-9. doi: 10.1016/j.visres.2007.10.022. Epub 2008 Jan 22.
12.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
13.
Genetic analysis of typical wet-type age-related macular degeneration and polypoidal choroidal vasculopathy in Japanese population.
Goto A, etal., J Ocul Biol Dis Infor. 2009 Dec 22;2(4):164-175.
14.
Analysis of six genetic risk factors highly associated with AMD in the region surrounding ARMS2 and HTRA1 on chromosome 10, region q26.
Hadley D, etal., Invest Ophthalmol Vis Sci. 2010 Apr;51(4):2191-6. doi: 10.1167/iovs.09-3798. Epub 2009 Nov 20.
15.
Association of pattern dystrophy with an HTRA1 single-nucleotide polymorphism.
Jaouni T, etal., Arch Ophthalmol. 2012 Aug;130(8):987-91. doi: 10.1001/archophthalmol.2012.1483.
16.
Increased expression of multifunctional serine protease, HTRA1, in retinal pigment epithelium induces polypoidal choroidal vasculopathy in mice.
Jones A, etal., Proc Natl Acad Sci U S A. 2011 Aug 30;108(35):14578-83. doi: 10.1073/pnas.1102853108. Epub 2011 Aug 15.
17.
Variants in the 10q26 gene cluster (LOC387715 and HTRA1) exhibit enhanced risk of age-related macular degeneration along with CFH in Indian patients.
Kaur I, etal., Invest Ophthalmol Vis Sci. 2008 May;49(5):1771-6. doi: 10.1167/iovs.07-0560.
18.
Quantitative determination of high-temperature requirement protein A1 and its possible associated molecules during induced reparative dentin formation.
Li X, etal., J Endod. 2012 Jun;38(6):814-20. doi: 10.1016/j.joen.2012.03.009.
19.
[Interaction of susceptibility genes in patients with exudative age-related macular degeneration].
Liang X, etal., Zhonghua Yan Ke Za Zhi. 2012 Mar;48(3):241-5.
20.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
21.
ARMS2/HTRA1 and CFH polymorphisms are not associated with choroidal neovascularization in highly myopic eyes of the elderly Japanese population.
Nakanishi H, etal., Eye (Lond). 2010 Jun;24(6):1078-84. doi: 10.1038/eye.2009.215. Epub 2009 Aug 14.
22.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
23.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
24.
GOA pipeline
RGD automated data pipeline
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Mutations in the IGF-II pathway that confer resistance to lytic reovirus infection.
Sheng J, etal., BMC Cell Biol. 2004 Aug 27;5:32.
28.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
29.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
30.
Association of genetic polymorphisms and age-related macular degeneration in Chinese population.
Tian J, etal., Invest Ophthalmol Vis Sci. 2012 Jun 28;53(7):4262-9. doi: 10.1167/iovs.11-8542.
31.
Characterization of a novel HDAC/RXR/HtrA1 signaling axis as a novel target to overcome cisplatin resistance in human non-small cell lung cancer.
Wang W, etal., Mol Cancer. 2020 Sep 2;19(1):134. doi: 10.1186/s12943-020-01256-9.
32.
Elevated serine protease HtrA1 inhibits cell proliferation, reduces invasion, and induces apoptosis in esophageal squamous cell carcinoma by blocking the nuclear factor-κB signaling pathway.
Xia J, etal., Tumour Biol. 2013 Feb;34(1):317-28. doi: 10.1007/s13277-012-0553-6. Epub 2012 Oct 19.
33.
HtrA1 Down-regulation Induces Cisplatin Resistance in Colon Cancer by Increasing XIAP and Activating PI3K/Akt Pathway.
Xiong Z, etal., Ann Clin Lab Sci. 2017 May;47(3):264-270.
34.
HtrA1 downregulation induces cisplatin resistance in lung adenocarcinoma by promoting cancer stem cell-like properties.
Xu Y, etal., J Cell Biochem. 2014 Jun;115(6):1112-21. doi: 10.1002/jcb.24751.
35.
Biologic Evaluation of Diabetes and Local Recurrence in Non-Small Cell Lung Cancer.
Yang X, etal., Pathol Oncol Res. 2017 Jan;23(1):73-77. doi: 10.1007/s12253-016-0086-1. Epub 2016 Jul 13.
36.
Effect of HtrA1 Polymorphism on Sensitivity to Chemotherapy in Patients with Colon Cancer.
Yao Y and Li N, Med Sci Monit. 2020 Mar 27;26:e921933. doi: 10.12659/MSM.921933.
37.
HtrA1 expression associated with the occurrence and development of esophageal cancer.
Yu Y, etal., World J Surg Oncol. 2012 Aug 30;10:179. doi: 10.1186/1477-7819-10-179.
38.
Serine protease HtrA1 as an inhibitor on proliferation invasion and migration of gastric cancer.
Zhao Z, etal., Med Oncol. 2015 Apr;32(4):112. doi: 10.1007/s12032-015-0524-z. Epub 2015 Mar 12.
39.
HtrA1 regulates epithelial-mesenchymal transition in hepatocellular carcinoma.
Zhu F, etal., Biochem Biophys Res Commun. 2015 Nov 20;467(3):589-94. doi: 10.1016/j.bbrc.2015.09.105. Epub 2015 Sep 25.
40.
Serine protease HtrA1 expression in human hepatocellular carcinoma.
Zhu F, etal., Hepatobiliary Pancreat Dis Int. 2010 Oct;9(5):508-12.
41.
Expression of HTRA Genes and Its Association with Microsatellite Instability and Survival of Patients with Colorectal Cancer.
Zurawa-Janicka D, etal., Int J Mol Sci. 2020 May 31;21(11). pii: ijms21113947. doi: 10.3390/ijms21113947.
Htra1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 194,928,069 - 194,977,619 (+) NCBI GRCr8 mRatBN7.2 1 185,497,815 - 185,547,380 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 185,497,735 - 185,547,379 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 193,848,030 - 193,897,573 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 201,026,602 - 201,075,741 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 193,698,377 - 193,747,515 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 201,499,067 - 201,548,508 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 201,499,028 - 201,548,513 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 208,532,013 - 208,581,538 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 190,257,899 - 190,308,325 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 190,407,779 - 190,458,206 (+) NCBI Celera 1 183,110,143 - 183,159,496 (+) NCBI Celera Cytogenetic Map 1 q41 NCBI
HTRA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 122,461,553 - 122,514,907 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 122,458,551 - 122,514,907 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 124,221,069 - 124,274,423 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 124,211,047 - 124,264,413 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 124,211,110 - 124,264,413 NCBI Celera 10 117,953,296 - 118,006,683 (+) NCBI Celera Cytogenetic Map 10 q26.13 NCBI HuRef 10 117,851,770 - 117,905,378 (+) NCBI HuRef CHM1_1 10 124,505,637 - 124,559,026 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 123,357,406 - 123,410,753 (+) NCBI T2T-CHM13v2.0
Htra1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 130,537,933 - 130,587,388 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 130,537,841 - 130,587,390 (+) Ensembl GRCm39 Ensembl GRCm38 7 130,936,203 - 130,985,658 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 130,936,111 - 130,985,660 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 138,079,717 - 138,129,172 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 130,727,377 - 130,776,801 (+) NCBI MGSCv36 mm8 Celera 7 130,747,058 - 130,797,116 (+) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 73.2 NCBI
Htra1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955477 761,127 - 808,994 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955477 761,127 - 808,396 (+) NCBI ChiLan1.0 ChiLan1.0
HTRA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 134,316,807 - 134,370,272 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 134,322,279 - 134,375,624 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 119,030,409 - 119,083,682 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 122,437,914 - 122,495,281 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 122,441,098 - 122,494,733 (+) Ensembl panpan1.1 panPan2
HTRA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 32,133,779 - 32,157,835 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 32,132,547 - 32,157,409 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 32,180,049 - 32,232,586 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 32,639,924 - 32,693,737 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 32,640,671 - 32,693,730 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 32,172,101 - 32,225,511 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 32,194,497 - 32,247,262 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 32,398,590 - 32,451,692 (+) NCBI UU_Cfam_GSD_1.0
Htra1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 14,244,028 - 14,290,168 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936486 11,271,130 - 11,316,739 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936486 11,271,130 - 11,317,271 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HTRA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 132,041,934 - 132,103,595 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 132,043,044 - 132,103,590 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 143,497,521 - 143,558,513 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HTRA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 115,197,543 - 115,250,092 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 115,197,566 - 115,253,919 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 76,496,054 - 76,549,359 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Htra1
.
Predicted Target Of
Count of predictions: 60 Count of miRNA genes: 47 Interacting mature miRNAs: 58 Transcripts: ENSRNOT00000027860 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 61378 Bp43 Blood pressure QTL 43 22.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 181746937 196383668 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat 2325725 Eae31 Experimental allergic encephalomyelitis QTL 31 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 178810256 188377506 Rat 631670 Iddm10 Insulin dependent diabetes mellitus QTL 10 1.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 174133260 196383668 Rat
D1Rat364
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 194,968,404 - 194,968,638 (+) Marker Load Pipeline mRatBN7.2 1 185,538,160 - 185,538,396 (+) MAPPER mRatBN7.2 Rnor_6.0 1 201,539,293 - 201,539,526 NCBI Rnor6.0 Rnor_5.0 1 208,572,323 - 208,572,556 UniSTS Rnor5.0 RGSC_v3.4 1 190,299,110 - 190,299,344 RGD RGSC3.4 RGSC_v3.4 1 190,299,111 - 190,299,344 UniSTS RGSC3.4 RGSC_v3.1 1 190,448,820 - 190,449,237 RGD Celera 1 183,150,289 - 183,150,522 UniSTS SHRSP x BN Map 1 94.7699 UniSTS SHRSP x BN Map 1 94.7699 RGD Cytogenetic Map 1 q37 UniSTS
BF393772
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 185,501,767 - 185,501,858 (+) MAPPER mRatBN7.2 Rnor_6.0 1 201,503,020 - 201,503,110 NCBI Rnor6.0 Rnor_5.0 1 208,535,966 - 208,536,056 UniSTS Rnor5.0 RGSC_v3.4 1 190,261,852 - 190,261,942 UniSTS RGSC3.4 Celera 1 183,114,096 - 183,114,186 UniSTS RH 3.4 Map 1 1422.5 UniSTS Cytogenetic Map 1 q37 UniSTS
BI274572
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 185,547,109 - 185,547,269 (+) MAPPER mRatBN7.2 Rnor_6.0 1 201,548,238 - 201,548,397 NCBI Rnor6.0 Rnor_5.0 1 208,581,268 - 208,581,427 UniSTS Rnor5.0 RGSC_v3.4 1 190,308,055 - 190,308,214 UniSTS RGSC3.4 Celera 1 183,159,226 - 183,159,385 UniSTS RH 3.4 Map 1 1427.0 UniSTS Cytogenetic Map 1 q37 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027860 ⟹ ENSRNOP00000027860
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 185,497,735 - 185,547,379 (+) Ensembl Rnor_6.0 Ensembl 1 201,499,028 - 201,548,513 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111703 ⟹ ENSRNOP00000083542
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 185,499,343 - 185,547,376 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115809 ⟹ ENSRNOP00000092383
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 185,497,817 - 185,547,376 (+) Ensembl
RefSeq Acc Id:
NM_031721 ⟹ NP_113909
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 194,928,069 - 194,977,619 (+) NCBI mRatBN7.2 1 185,497,815 - 185,547,380 (+) NCBI Rnor_6.0 1 201,499,067 - 201,548,508 (+) NCBI Rnor_5.0 1 208,532,013 - 208,581,538 (+) NCBI RGSC_v3.4 1 190,257,899 - 190,308,325 (+) RGD Celera 1 183,110,143 - 183,159,496 (+) RGD
Sequence:
ATTTTCGGCTGTGGTCCAGCCCGTGGCCGTCGGAGTCGCCATGCAGTTCCTGCGTACCGCGCTCCTGTCTTTGCTACTGCTGCTGCTGGCGGCTCCCTCTTTGGCGTTGCCGTCGGGGATCAGCCGCT
hide sequence
RefSeq Acc Id:
NP_113909 ⟸ NM_031721
- Peptide Label:
precursor
- UniProtKB:
Q9QZK5 (UniProtKB/Swiss-Prot), A0A8L2QHG9 (UniProtKB/TrEMBL)
- Sequence:
MQFLRTALLSLLLLLLAAPSLALPSGISRSAPAATVCPEHCDPTRCAPPPTDCEGGRVRDACGCCEVCGALEGAVCGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDAKTYTN
hide sequence
Ensembl Acc Id:
ENSRNOP00000027860 ⟸ ENSRNOT00000027860
Ensembl Acc Id:
ENSRNOP00000092383 ⟸ ENSRNOT00000115809
Ensembl Acc Id:
ENSRNOP00000083542 ⟸ ENSRNOT00000111703
RGD ID: 13690471 Promoter ID: EPDNEW_R996 Type: initiation region Name: Htra1_1 Description: HtrA serine peptidase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 201,499,019 - 201,499,079 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Htra1
HtrA serine peptidase 1
Prss11
protease, serine, 11 (Igf binding)
Symbol and Name updated
1299863 APPROVED
2004-09-10
Prss11
protease, serine, 11 (Igf binding)
protease, serine, 11
Name updated
1299863 APPROVED
2002-06-10
Prss11
protease, serine, 11
Name updated
70584 APPROVED
