Symbol:
Fabp3
Name:
fatty acid binding protein 3
RGD ID:
69048
Description:
Enables icosatetraenoic acid binding activity and long-chain fatty acid transmembrane transporter activity. Involved in several processes, including long-chain fatty acid transport; response to fatty acid; and response to insulin. Located in sarcoplasm. Human ortholog(s) of this gene implicated in hypertension and type 2 diabetes mellitus. Orthologous to human FABP3 (fatty acid binding protein 3); PARTICIPATES IN integrin mediated signaling pathway; eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma; INTERACTS WITH (R)-adrenaline; (R)-carnitine; 1,3,4-thiadiazole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Fatty acid binding protein 3 heart; Fatty acid binding protein 3 muscle and heart; Fatty acid binding protein 3, heart; fatty acid binding protein 3, muscle and heart; fatty acid-binding protein 3; fatty acid-binding protein, heart; H-FABP; heart fatty acid binding protein; heart-type fatty acid-binding protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FABP3 (fatty acid binding protein 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Fabp3 (fatty acid binding protein 3, muscle and heart) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fabp3 (fatty acid binding protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FABP3 (fatty acid binding protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FABP3 (fatty acid binding protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fabp3 (fatty acid binding protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FABP3 (fatty acid binding protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FABP3 (fatty acid binding protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fabp3 (fatty acid binding protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TNRC6A (trinucleotide repeat containing adaptor 6A) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
FABP3 (fatty acid binding protein 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fabp3 (fatty acid binding protein 3, muscle and heart)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fabp3 (fatty acid binding protein 3, muscle and heart)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lbp-5
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lbp-6
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lbp-7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lbp-8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
fabp
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fabp3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,936,027 - 147,942,870 (+) NCBI GRCr8 mRatBN7.2 5 142,651,962 - 142,658,707 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 142,651,956 - 142,658,718 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 145,351,237 - 145,357,980 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 147,121,043 - 147,127,786 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 147,118,434 - 147,125,177 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 148,528,854 - 148,535,597 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 148,528,725 - 148,535,565 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 152,246,250 - 152,252,993 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 149,340,525 - 149,347,268 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 149,350,578 - 149,357,307 (+) NCBI Celera 5 141,118,398 - 141,125,141 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fabp3 Rat (R)-adrenaline affects expression EXP 6480464 Epinephrine affects the expression of FABP3 protein CTD PMID:19464573 Fabp3 Rat (R)-adrenaline multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of FABP3 protein CTD PMID:19464573 Fabp3 Rat (R)-carnitine multiple interactions EXP 6480464 Carnitine inhibits the reaction [Doxorubicin results in decreased expression of FABP3 mRNA] CTD PMID:20470772 Fabp3 Rat 1,1-dichloroethene decreases expression ISO Fabp3 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of FABP3 mRNA CTD PMID:26682919 Fabp3 Rat 1,2-dimethylhydrazine multiple interactions ISO Fabp3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of FABP3 mRNA CTD PMID:22206623 Fabp3 Rat 1,3,4-thiadiazole affects expression EXP 6480464 1 more ... CTD PMID:30905023 Fabp3 Rat 11-deoxycorticosterone multiple interactions EXP 6480464 [Desoxycorticosterone co-treated with Sodium Chloride more ... CTD PMID:21135038 Fabp3 Rat 17alpha-ethynylestradiol multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of FABP3 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FABP3 mRNA CTD PMID:17942748 and PMID:37844793 Fabp3 Rat 17alpha-ethynylestradiol decreases expression ISO Fabp3 (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of FABP3 mRNA CTD PMID:17555576 Fabp3 Rat 17beta-estradiol decreases expression ISO Fabp3 (Mus musculus) 6480464 Estradiol results in decreased expression of FABP3 mRNA CTD PMID:19484750 Fabp3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FABP3 mRNA CTD PMID:17942748 Fabp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FABP3 mRNA CTD PMID:32109520 Fabp3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Fabp3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Fabp3 Rat 2,4-dinitrotoluene decreases expression ISO Fabp3 (Mus musculus) 6480464 2 and 4-dinitrotoluene results in decreased expression of FABP3 mRNA CTD PMID:24893713 Fabp3 Rat 2-Ethylhexanoic acid increases expression EXP 6480464 2-ethylhexanoic acid results in increased expression of FABP3 mRNA and 2-ethylhexanoic acid results in increased expression of FABP3 protein CTD PMID:15647598 Fabp3 Rat 2-palmitoylglycerol increases expression ISO FABP3 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of FABP3 mRNA CTD PMID:37199045 Fabp3 Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine decreases expression ISO Fabp3 (Mus musculus) 6480464 3 more ... CTD PMID:20512997 Fabp3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Fabp3 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of FABP3 mRNA CTD PMID:23428407 Fabp3 Rat 4,4'-sulfonyldiphenol increases expression ISO FABP3 (Homo sapiens) 6480464 bisphenol S results in increased expression of FABP3 mRNA and bisphenol S results in increased expression of FABP3 protein CTD PMID:27685785 and PMID:34186270 Fabp3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FABP3 mRNA CTD PMID:36041667 Fabp3 Rat 5-aza-2'-deoxycytidine affects expression ISO FABP3 (Homo sapiens) 6480464 Decitabine affects the expression of FABP3 mRNA CTD PMID:23300844 Fabp3 Rat 7H-xanthine multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of FABP3 protein and [Xanthine co-treated with XDH protein] results in decreased expression of FABP3 protein CTD PMID:19464573 Fabp3 Rat 9H-xanthine multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of FABP3 protein and [Xanthine co-treated with XDH protein] results in decreased expression of FABP3 protein CTD PMID:19464573 Fabp3 Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of FABP3 protein CTD PMID:33236894 Fabp3 Rat Allylamine increases expression EXP 6480464 Allylamine results in increased expression of FABP3 protein CTD PMID:22878004 Fabp3 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] affects the expression of FABP3 mRNA CTD PMID:35163327 Fabp3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FABP3 mRNA CTD PMID:16483693 Fabp3 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of FABP3 mRNA CTD PMID:30779732 Fabp3 Rat aristolochic acid A increases expression ISO FABP3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of FABP3 mRNA CTD PMID:33212167 Fabp3 Rat Aroclor 1254 increases expression ISO Fabp3 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of FABP3 mRNA CTD PMID:25270620 Fabp3 Rat arsane multiple interactions ISO Fabp3 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FABP3 mRNA CTD PMID:32045263 Fabp3 Rat arsenic atom multiple interactions ISO Fabp3 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FABP3 mRNA CTD PMID:32045263 Fabp3 Rat arsenite(3-) multiple interactions ISO Fabp3 (Mus musculus) 6480464 TRP53 protein affects the reaction [arsenite results in increased expression of FABP3 mRNA] CTD PMID:18929588 Fabp3 Rat arsenite(3-) increases expression ISO Fabp3 (Mus musculus) 6480464 arsenite results in increased expression of FABP3 mRNA CTD PMID:18929588 Fabp3 Rat arsenous acid increases expression ISO FABP3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of FABP3 mRNA CTD PMID:36801614 Fabp3 Rat belinostat multiple interactions ISO FABP3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FABP3 mRNA CTD PMID:27188386 Fabp3 Rat benzatropine increases expression ISO FABP3 (Homo sapiens) 6480464 Benztropine results in increased expression of FABP3 protein CTD PMID:34122009 Fabp3 Rat benzo[a]pyrene affects methylation ISO FABP3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FABP3 promoter CTD PMID:27901495 Fabp3 Rat benzo[b]fluoranthene decreases expression ISO Fabp3 (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of FABP3 mRNA CTD PMID:26377693 Fabp3 Rat bexarotene multiple interactions EXP 6480464 [bexarotene co-treated with Tamoxifen] results in increased expression of FABP3 mRNA CTD PMID:17630414 Fabp3 Rat bezafibrate decreases expression ISO FABP3 (Homo sapiens) 6480464 Bezafibrate results in decreased expression of FABP3 mRNA CTD PMID:15708366 Fabp3 Rat bezafibrate affects expression EXP 6480464 Bezafibrate affects the expression of FABP3 mRNA CTD PMID:30905023 Fabp3 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of FABP3 mRNA and Diethylhexyl Phthalate results in increased expression of FABP3 protein CTD PMID:15647598 Fabp3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Fabp3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of FABP3 mRNA CTD PMID:34319233 and PMID:35550907 Fabp3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Fabp3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of FABP3 mRNA CTD PMID:30284816 and PMID:34595713 Fabp3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FABP3 mRNA and [Fructose co-treated with bisphenol A] results in increased expression of FABP3 protein CTD PMID:26930160 and PMID:36041667 Fabp3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FABP3 mRNA and bisphenol A results in increased expression of FABP3 protein CTD PMID:32145629 and PMID:39307384 Fabp3 Rat bisphenol A decreases expression ISO FABP3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of FABP3 mRNA and bisphenol A results in decreased expression of FABP3 protein CTD PMID:31715268 and PMID:34186270 Fabp3 Rat bisphenol A decreases expression ISO Fabp3 (Mus musculus) 6480464 bisphenol A results in decreased expression of FABP3 mRNA CTD PMID:30951980 and PMID:35598803 Fabp3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FABP3 mRNA CTD PMID:24105817 Fabp3 Rat bisphenol A increases expression ISO FABP3 (Homo sapiens) 6480464 bisphenol A results in increased expression of FABP3 mRNA and bisphenol A results in increased expression of FABP3 protein CTD PMID:27685785 and PMID:37567409 Fabp3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of FABP3 mRNA CTD PMID:18180321 and PMID:25181051 Fabp3 Rat bisphenol AF increases expression ISO FABP3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of FABP3 protein CTD PMID:34186270 Fabp3 Rat Bisphenol B increases expression ISO FABP3 (Homo sapiens) 6480464 bisphenol B results in increased expression of FABP3 protein CTD PMID:34186270 Fabp3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FABP3 mRNA CTD PMID:36041667 Fabp3 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of FABP3 protein CTD PMID:28903499 Fabp3 Rat cadmium dichloride decreases expression ISO Fabp3 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of FABP3 mRNA and Cadmium Chloride results in decreased expression of FABP3 protein CTD PMID:31152847 Fabp3 Rat cadmium dichloride increases expression ISO FABP3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of FABP3 mRNA CTD PMID:38568856 Fabp3 Rat cantharidin decreases expression ISO Fabp3 (Mus musculus) 6480464 Cantharidin results in decreased expression of FABP3 mRNA CTD PMID:36907384 Fabp3 Rat carbofuran increases expression EXP 6480464 Carbofuran results in increased expression of FABP3 protein CTD PMID:19854236 Fabp3 Rat carbon nanotube affects expression ISO Fabp3 (Mus musculus) 6480464 Nanotubes and Carbon analog affects the expression of FABP3 mRNA CTD PMID:25554681 Fabp3 Rat carbon nanotube increases expression ISO Fabp3 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of FABP3 mRNA CTD PMID:25620056 Fabp3 Rat carbon nanotube decreases expression ISO Fabp3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Fabp3 Rat CGP 52608 multiple interactions ISO FABP3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FABP3 gene] CTD PMID:28238834 Fabp3 Rat chlorpyrifos increases expression ISO Fabp3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of FABP3 mRNA CTD PMID:37019170 Fabp3 Rat choline multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FABP3 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FABP3 gene CTD PMID:20938992 Fabp3 Rat chromium(6+) increases expression ISO FABP3 (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of FABP3 mRNA CTD PMID:17382205 Fabp3 Rat cisplatin affects expression ISO FABP3 (Homo sapiens) 6480464 Cisplatin affects the expression of FABP3 mRNA CTD PMID:23300844 Fabp3 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of FABP3 mRNA CTD PMID:12851107 Fabp3 Rat clofibrate increases expression ISO Fabp3 (Mus musculus) 6480464 Clofibrate results in increased expression of FABP3 mRNA CTD PMID:25270620 Fabp3 Rat cobalt dichloride decreases expression ISO FABP3 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of FABP3 mRNA CTD PMID:15708366 Fabp3 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of FABP3 mRNA CTD PMID:30556269 Fabp3 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of FABP3 mRNA CTD PMID:30556269 Fabp3 Rat corilagin multiple interactions EXP 6480464 corilagin inhibits the reaction [Doxorubicin results in increased expression of FABP3 protein] CTD PMID:34369273 Fabp3 Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of FABP3 mRNA CTD PMID:15755911 Fabp3 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Gentamicins results in increased expression of FABP3 mRNA] CTD PMID:38056816 Fabp3 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of FABP3 protein CTD PMID:22878004 Fabp3 Rat cyclosporin A decreases expression ISO FABP3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FABP3 mRNA CTD PMID:27989131 Fabp3 Rat deoxynivalenol decreases expression ISO FABP3 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of FABP3 mRNA CTD PMID:31863870 Fabp3 Rat dexamethasone multiple interactions ISO Fabp3 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of FABP3 mRNA CTD PMID:23428407 Fabp3 Rat dexamethasone increases expression ISO FABP3 (Homo sapiens) 6480464 Dexamethasone results in increased expression of FABP3 mRNA CTD PMID:25047013 Fabp3 Rat diarsenic trioxide increases expression ISO FABP3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of FABP3 mRNA CTD PMID:36801614 Fabp3 Rat Dibutyl phosphate affects expression ISO FABP3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of FABP3 mRNA CTD PMID:37042841 Fabp3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of FABP3 mRNA CTD PMID:21266533 and PMID:21745491 Fabp3 Rat dichloroacetic acid decreases expression ISO Fabp3 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of FABP3 mRNA CTD PMID:28962523 Fabp3 Rat diclofenac multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of FABP3 mRNA CTD PMID:37844793 Fabp3 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of FABP3 mRNA CTD PMID:21658437 Fabp3 Rat diisononyl phthalate increases expression ISO Fabp3 (Mus musculus) 6480464 diisononyl phthalate results in increased expression of FABP3 mRNA CTD PMID:33391822 Fabp3 Rat dimethylarsinic acid multiple interactions ISO Fabp3 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of FABP3 mRNA CTD PMID:34876320 Fabp3 Rat Diosbulbin B decreases activity ISO Fabp3 (Mus musculus) 6480464 diosbulbin B results in decreased activity of FABP3 protein CTD PMID:32148032 Fabp3 Rat Diosbulbin B decreases expression ISO Fabp3 (Mus musculus) 6480464 diosbulbin B results in decreased expression of FABP3 mRNA CTD PMID:32148032 Fabp3 Rat dioxygen increases expression ISO FABP3 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of FABP3 mRNA and Oxygen deficiency results in increased expression of FABP3 protein CTD PMID:24236059 and PMID:34648812 Fabp3 Rat dioxygen multiple interactions ISO FABP3 (Homo sapiens) 6480464 [FV-429 compound co-treated with Paclitaxel] inhibits the reaction [Oxygen deficiency results in increased expression of FABP3 protein] CTD PMID:34648812 Fabp3 Rat dioxygen multiple interactions ISO Fabp3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of FABP3 mRNA CTD PMID:30529165 Fabp3 Rat dioxygen decreases expression ISO FABP3 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of FABP3 mRNA CTD PMID:25596134 Fabp3 Rat dorsomorphin multiple interactions ISO FABP3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fabp3 Rat doxorubicin multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Doxorubicin co-treated with MT2A protein] results in increased expression of FABP3 protein and sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of FABP3 protein] CTD PMID:16144979 and PMID:21251210 Fabp3 Rat doxorubicin affects expression ISO FABP3 (Homo sapiens) 6480464 Doxorubicin affects the expression of FABP3 mRNA CTD PMID:29803840 Fabp3 Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of FABP3 protein CTD PMID:28818578 Fabp3 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of FABP3 protein CTD PMID:32691977 and PMID:34369273 Fabp3 Rat doxorubicin increases expression ISO Fabp3 (Mus musculus) 6480464 Doxorubicin results in increased expression of FABP3 protein CTD PMID:21251210 Fabp3 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of FABP3 mRNA CTD PMID:20470772 Fabp3 Rat doxorubicin multiple interactions EXP 6480464 Carnitine inhibits the reaction [Doxorubicin results in decreased expression of FABP3 mRNA] more ... CTD PMID:20470772 more ... Fabp3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of FABP3 mRNA CTD PMID:29391264 Fabp3 Rat entinostat increases expression ISO FABP3 (Homo sapiens) 6480464 entinostat results in increased expression of FABP3 mRNA CTD PMID:26272509 Fabp3 Rat entinostat multiple interactions ISO FABP3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FABP3 mRNA CTD PMID:27188386 Fabp3 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of FABP3 protein CTD PMID:24646710 Fabp3 Rat ethanol increases expression ISO Fabp3 (Mus musculus) 6480464 Ethanol results in increased expression of FABP3 mRNA CTD PMID:30319688 Fabp3 Rat ethylparaben increases expression ISO FABP3 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of FABP3 mRNA CTD PMID:37690743 Fabp3 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of FABP3 mRNA CTD PMID:25596134 Fabp3 Rat ferroheme b increases expression ISO Fabp3 (Mus musculus) 6480464 Heme metabolite results in increased expression of FABP3 mRNA CTD PMID:19191707 Fabp3 Rat fluoxetine increases expression ISO FABP3 (Homo sapiens) 6480464 Fluoxetine results in increased expression of FABP3 mRNA CTD PMID:37386098 Fabp3 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of FABP3 mRNA and Flutamide results in increased expression of FABP3 protein CTD PMID:17311803 and PMID:19299419 Fabp3 Rat folic acid multiple interactions ISO Fabp3 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Fabp3 Rat fructose multiple interactions EXP 6480464 [Fructose co-treated with bisphenol A] results in increased expression of FABP3 protein CTD PMID:26930160 Fabp3 Rat furan decreases expression ISO Fabp3 (Mus musculus) 6480464 furan results in decreased expression of FABP3 mRNA CTD PMID:24183702 Fabp3 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of FABP3 mRNA CTD PMID:17341692 Fabp3 Rat genistein increases expression ISO Fabp3 (Mus musculus) 6480464 Genistein results in increased expression of FABP3 mRNA CTD PMID:32186404 Fabp3 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with vinclozolin] results in increased expression of FABP3 mRNA CTD PMID:23160963 Fabp3 Rat gentamycin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Gentamicins results in increased expression of FABP3 mRNA] CTD PMID:38056816 Fabp3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of FABP3 mRNA CTD PMID:38056816 Fabp3 Rat graphite increases expression ISO Fabp3 (Mus musculus) 6480464 Graphite results in increased expression of FABP3 mRNA CTD PMID:27440207 Fabp3 Rat haloperidol affects response to substance ISO Fabp3 (Mus musculus) 6480464 FABP3 affects the susceptibility to Haloperidol CTD PMID:20181611 Fabp3 Rat haloperidol increases expression ISO FABP3 (Homo sapiens) 6480464 Haloperidol results in increased expression of FABP3 protein CTD PMID:34122009 Fabp3 Rat heme b increases expression ISO Fabp3 (Mus musculus) 6480464 Heme metabolite results in increased expression of FABP3 mRNA CTD PMID:19191707 Fabp3 Rat ibuprofen multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of FABP3 mRNA CTD PMID:37844793 Fabp3 Rat ifosfamide decreases expression ISO FABP3 (Homo sapiens) 6480464 Ifosfamide results in decreased expression of FABP3 mRNA CTD PMID:25596134 Fabp3 Rat iohexol increases expression ISO FABP3 (Homo sapiens) 6480464 Iohexol results in increased expression of FABP3 mRNA CTD PMID:29705293 Fabp3 Rat iopamidol increases expression ISO FABP3 (Homo sapiens) 6480464 Iopamidol results in increased expression of FABP3 mRNA CTD PMID:29705293 Fabp3 Rat isoprenaline increases expression ISO Fabp3 (Mus musculus) 6480464 Isoproterenol results in increased expression of FABP3 protein CTD PMID:19549929 Fabp3 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of FABP3 protein CTD PMID:19854236 and PMID:22878004 Fabp3 Rat isoprenaline decreases expression EXP 6480464 Isoproterenol results in decreased expression of FABP3 protein CTD PMID:19826179 Fabp3 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of FABP3 mRNA CTD PMID:37077353 Fabp3 Rat L-methionine multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FABP3 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FABP3 gene CTD PMID:20938992 Fabp3 Rat linoleic acid decreases expression ISO FABP3 (Homo sapiens) 6480464 Linoleic Acid results in decreased expression of FABP3 mRNA CTD PMID:15708366 Fabp3 Rat maneb multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of FABP3 mRNA CTD PMID:36117858 Fabp3 Rat metaproterenol increases expression EXP 6480464 Metaproterenol results in increased expression of FABP3 protein CTD PMID:22878004 Fabp3 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of FABP3 mRNA CTD PMID:25596134 Fabp3 Rat methamphetamine affects response to substance ISO Fabp3 (Mus musculus) 6480464 FABP3 affects the susceptibility to Methamphetamine CTD PMID:20181611 Fabp3 Rat methamphetamine increases expression ISO FABP3 (Homo sapiens) 6480464 Methamphetamine results in increased expression of FABP3 mRNA CTD PMID:25290377 Fabp3 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of FABP3 mRNA CTD PMID:30047161 Fabp3 Rat methylarsonic acid multiple interactions ISO Fabp3 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of FABP3 mRNA CTD PMID:34876320 Fabp3 Rat methylisothiazolinone increases expression ISO FABP3 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of FABP3 mRNA CTD PMID:31629900 Fabp3 Rat methylmercury chloride increases expression ISO FABP3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of FABP3 mRNA CTD PMID:28001369 Fabp3 Rat mitoxantrone increases expression EXP 6480464 Mitoxantrone results in increased expression of FABP3 protein CTD PMID:22878004 Fabp3 Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of FABP3 mRNA and mono-(2-ethylhexyl)phthalate results in increased expression of FABP3 protein CTD PMID:12706301 and PMID:15647598 Fabp3 Rat N-methyl-4-phenylpyridinium increases expression ISO FABP3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of FABP3 mRNA CTD PMID:24810058 Fabp3 Rat N-methyl-N-nitrosourea increases expression EXP 6480464 Methylnitrosourea results in increased expression of FABP3 mRNA CTD PMID:17341692 Fabp3 Rat nickel sulfate increases expression ISO FABP3 (Homo sapiens) 6480464 nickel sulfate results in increased expression of FABP3 mRNA CTD PMID:17382205 Fabp3 Rat nickel sulfate decreases expression ISO FABP3 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of FABP3 mRNA CTD PMID:22714537 Fabp3 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of FABP3 mRNA CTD PMID:33484710 Fabp3 Rat orciprenaline increases expression EXP 6480464 Metaproterenol results in increased expression of FABP3 protein CTD PMID:22878004 Fabp3 Rat ozone decreases expression ISO Fabp3 (Mus musculus) 6480464 Ozone results in decreased expression of FABP3 mRNA CTD PMID:12763052 Fabp3 Rat ozone multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of FABP3 mRNA CTD PMID:34911549 Fabp3 Rat paclitaxel multiple interactions ISO FABP3 (Homo sapiens) 6480464 [FV-429 compound co-treated with Paclitaxel] inhibits the reaction [Oxygen deficiency results in increased expression of FABP3 protein] CTD PMID:34648812 Fabp3 Rat panobinostat multiple interactions ISO FABP3 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FABP3 mRNA CTD PMID:27188386 Fabp3 Rat panobinostat increases expression ISO FABP3 (Homo sapiens) 6480464 panobinostat results in increased expression of FABP3 mRNA CTD PMID:26272509 Fabp3 Rat paraquat multiple interactions ISO Fabp3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of FABP3 mRNA CTD PMID:36117858 Fabp3 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of FABP3 mRNA CTD PMID:19162173 more ... Fabp3 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] affects the expression of FABP3 mRNA CTD PMID:35163327 Fabp3 Rat perfluorooctanoic acid increases expression ISO Fabp3 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of FABP3 mRNA CTD PMID:23626681 and PMID:30711707 Fabp3 Rat perfluorooctanoic acid multiple interactions ISO Fabp3 (Mus musculus) 6480464 Dietary Fats and Unsaturated promotes the reaction [perfluorooctanoic acid results in increased expression of FABP3 mRNA] CTD PMID:23626681 Fabp3 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of FABP3 mRNA CTD PMID:19162173 Fabp3 Rat phenobarbital affects expression ISO Fabp3 (Mus musculus) 6480464 Phenobarbital affects the expression of FABP3 mRNA CTD PMID:23091169 Fabp3 Rat phosphorus atom increases expression ISO FABP3 (Homo sapiens) 6480464 Phosphorus results in increased expression of FABP3 mRNA CTD PMID:17715259 Fabp3 Rat phosphorus(.) increases expression ISO FABP3 (Homo sapiens) 6480464 Phosphorus results in increased expression of FABP3 mRNA CTD PMID:17715259 Fabp3 Rat pioglitazone multiple interactions ISO Fabp3 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of FABP3 mRNA CTD PMID:27935865 Fabp3 Rat pirinixic acid multiple interactions ISO Fabp3 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of FABP3 mRNA more ... CTD PMID:15833283 more ... Fabp3 Rat pirinixic acid increases expression ISO Fabp3 (Mus musculus) 6480464 pirinixic acid results in increased expression of FABP3 mRNA CTD PMID:15833283 more ... Fabp3 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of FABP3 mRNA CTD PMID:19162173 and PMID:22484513 Fabp3 Rat plumbagin multiple interactions EXP 6480464 plumbagin inhibits the reaction [Doxorubicin results in increased expression of FABP3 protein] CTD PMID:32691977 Fabp3 Rat potassium chromate increases expression ISO FABP3 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of FABP3 mRNA CTD PMID:17382205 Fabp3 Rat potassium dichromate increases expression ISO FABP3 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of FABP3 mRNA CTD PMID:11678601 Fabp3 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of FABP3 mRNA CTD PMID:20726854 Fabp3 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of FABP3 mRNA CTD PMID:25905778 Fabp3 Rat rotenone increases expression ISO FABP3 (Homo sapiens) 6480464 Rotenone results in increased expression of FABP3 mRNA CTD PMID:29955902 Fabp3 Rat SB 431542 multiple interactions ISO FABP3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fabp3 Rat sodium arsenate multiple interactions ISO Fabp3 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of FABP3 mRNA CTD PMID:34876320 Fabp3 Rat sodium arsenite increases secretion EXP 6480464 sodium arsenite results in increased secretion of FABP3 protein CTD PMID:32736004 Fabp3 Rat sodium arsenite multiple interactions ISO Fabp3 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of FABP3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FABP3 mRNA CTD PMID:32045263 and PMID:34876320 Fabp3 Rat sodium arsenite multiple interactions ISO FABP3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of and affects the splicing of FABP3 mRNA CTD PMID:25879800 Fabp3 Rat sodium dodecyl sulfate increases expression ISO FABP3 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of FABP3 mRNA CTD PMID:31734321 Fabp3 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of FABP3 mRNA CTD PMID:27257137 Fabp3 Rat sodium nitrate multiple interactions ISO Fabp3 (Mus musculus) 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of FABP3 protein] CTD PMID:21251210 Fabp3 Rat sulforaphane increases expression ISO Fabp3 (Mus musculus) 6480464 sulforaphane results in increased expression of FABP3 mRNA CTD PMID:30529165 Fabp3 Rat sulforaphane decreases expression ISO FABP3 (Homo sapiens) 6480464 sulforaphane results in decreased expression of FABP3 mRNA CTD PMID:31838189 Fabp3 Rat sunitinib decreases expression ISO FABP3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of FABP3 mRNA CTD PMID:31533062 Fabp3 Rat tamoxifen affects expression ISO Fabp3 (Mus musculus) 6480464 Tamoxifen affects the expression of FABP3 mRNA CTD PMID:17555576 Fabp3 Rat tamoxifen multiple interactions EXP 6480464 [bexarotene co-treated with Tamoxifen] results in increased expression of FABP3 mRNA CTD PMID:17630414 Fabp3 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of FABP3 mRNA CTD PMID:21515302 Fabp3 Rat testosterone increases expression ISO Fabp3 (Mus musculus) 6480464 Testosterone results in increased expression of FABP3 mRNA CTD PMID:19693291 Fabp3 Rat tetrachloromethane increases expression ISO Fabp3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of FABP3 mRNA CTD PMID:17484886 Fabp3 Rat titanium dioxide decreases expression ISO Fabp3 (Mus musculus) 6480464 titanium dioxide results in decreased expression of FABP3 mRNA CTD PMID:23557971 Fabp3 Rat titanium dioxide decreases methylation ISO Fabp3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FABP3 gene and titanium dioxide results in decreased methylation of FABP3 promoter CTD PMID:35295148 Fabp3 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of FABP3 mRNA CTD PMID:22967744 Fabp3 Rat topiramate decreases expression EXP 6480464 topiramate results in decreased expression of FABP3 mRNA CTD PMID:16979414 Fabp3 Rat tributylstannane increases expression ISO Fabp3 (Mus musculus) 6480464 tributyltin results in increased expression of FABP3 mRNA CTD PMID:23428407 Fabp3 Rat Tributyltin oxide increases expression ISO Fabp3 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in increased expression of FABP3 mRNA CTD PMID:18958704 Fabp3 Rat trichloroethene affects expression ISO Fabp3 (Mus musculus) 6480464 Trichloroethylene affects the expression of FABP3 mRNA CTD PMID:21135412 Fabp3 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of FABP3 mRNA CTD PMID:33387578 Fabp3 Rat triclosan decreases expression ISO FABP3 (Homo sapiens) 6480464 Triclosan results in decreased expression of FABP3 mRNA CTD PMID:30510588 Fabp3 Rat troglitazone decreases expression ISO FABP3 (Homo sapiens) 6480464 troglitazone results in decreased expression of FABP3 mRNA CTD PMID:11162573 Fabp3 Rat troglitazone increases expression ISO FABP3 (Homo sapiens) 6480464 troglitazone results in increased expression of FABP3 protein CTD PMID:9709955 Fabp3 Rat tunicamycin decreases expression ISO Fabp3 (Mus musculus) 6480464 Tunicamycin results in decreased expression of FABP3 mRNA CTD PMID:17127020 Fabp3 Rat valproic acid increases expression ISO FABP3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FABP3 mRNA CTD PMID:23179753 more ... Fabp3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of FABP3 mRNA CTD PMID:23160963 Fabp3 Rat vinclozolin multiple interactions EXP 6480464 [Genistein co-treated with vinclozolin] results in increased expression of FABP3 mRNA CTD PMID:23160963 Fabp3 Rat vitamin E increases expression ISO FABP3 (Homo sapiens) 6480464 Vitamin E results in increased expression of FABP3 mRNA CTD PMID:19244175 Fabp3 Rat vorinostat multiple interactions ISO FABP3 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FABP3 mRNA CTD PMID:27188386 Fabp3 Rat vorinostat increases expression ISO FABP3 (Homo sapiens) 6480464 vorinostat results in increased expression of FABP3 mRNA CTD PMID:26272509 Fabp3 Rat vorinostat decreases expression ISO FABP3 (Homo sapiens) 6480464 vorinostat results in decreased expression of FABP3 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(R)-adrenaline (EXP) (R)-carnitine (EXP) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1,3,4-thiadiazole (EXP) 11-deoxycorticosterone (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (ISO) 2-Ethylhexanoic acid (EXP) 2-palmitoylglycerol (ISO) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-aza-2'-deoxycytidine (ISO) 7H-xanthine (EXP) 9H-xanthine (EXP) aconitine (EXP) Allylamine (EXP) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) belinostat (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bexarotene (EXP) bezafibrate (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP) Brodifacoum (EXP) cadmium dichloride (ISO) cantharidin (ISO) carbofuran (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (EXP,ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) corilagin (EXP) corticosterone (EXP) curcumin (EXP) cyclosporin A (EXP,ISO) deoxynivalenol (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dichloroacetic acid (ISO) diclofenac (ISO) diethylstilbestrol (EXP) diisononyl phthalate (ISO) dimethylarsinic acid (ISO) Diosbulbin B (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) entinostat (ISO) ethanol (EXP,ISO) ethylparaben (ISO) fenofibrate (EXP) ferroheme b (ISO) fluoxetine (ISO) flutamide (EXP) folic acid (ISO) fructose (EXP) furan (ISO) genistein (EXP,ISO) gentamycin (EXP) graphite (ISO) haloperidol (ISO) heme b (ISO) ibuprofen (ISO) ifosfamide (ISO) iohexol (ISO) iopamidol (ISO) isoprenaline (EXP,ISO) ketoconazole (EXP) L-methionine (ISO) linoleic acid (ISO) maneb (ISO) metaproterenol (EXP) metformin (EXP) methamphetamine (ISO) methimazole (EXP) methylarsonic acid (ISO) methylisothiazolinone (ISO) methylmercury chloride (ISO) mitoxantrone (EXP) mono(2-ethylhexyl) phthalate (EXP) N-methyl-4-phenylpyridinium (ISO) N-methyl-N-nitrosourea (EXP) nickel sulfate (ISO) nitrofen (EXP) orciprenaline (EXP) ozone (ISO) paclitaxel (ISO) panobinostat (ISO) paraquat (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (EXP,ISO) phosphorus atom (ISO) phosphorus(.) (ISO) pioglitazone (ISO) pirinixic acid (EXP,ISO) plumbagin (EXP) potassium chromate (ISO) potassium dichromate (ISO) progesterone (EXP) resveratrol (EXP) rotenone (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium dodecyl sulfate (ISO) sodium fluoride (EXP) sodium nitrate (ISO) sulforaphane (ISO) sunitinib (ISO) tamoxifen (EXP,ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) toluene (EXP) topiramate (EXP) tributylstannane (ISO) Tributyltin oxide (ISO) trichloroethene (EXP,ISO) triclosan (ISO) troglitazone (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO)
Biological Process
brown fat cell differentiation (IEA,ISO) cholesterol homeostasis (IEA,ISO) fatty acid beta-oxidation (NAS) fatty acid metabolic process (IEP) intracellular lipid transport (IEA,ISO) long-chain fatty acid transport (IBA,IDA,IEA,ISO) phospholipid homeostasis (IEA,ISO) positive regulation of long-chain fatty acid import into cell (IEA,ISO) regulation of fatty acid oxidation (IEA,ISO) regulation of phosphatidylcholine biosynthetic process (IEA,ISO) response to fatty acid (IEP) response to insulin (IEP) response to xenobiotic stimulus (IEP)
1.
Integrin inactivators: balancing cellular functions in vitro and in vivo.
Bouvard D, etal., Nat Rev Mol Cell Biol. 2013 Jul;14(7):430-42. doi: 10.1038/nrm3599. Epub 2013 May 30.
2.
Heart type fatty acid binding protein (H-FABP) is decreased in brains of patients with Down syndrome and Alzheimer's disease.
Cheon MS, etal., J Neural Transm Suppl. 2003;(67):225-34.
3.
Cloning and tissue distribution of rat heart fatty acid binding protein mRNA: identical forms in heart and skeletal muscle.
Claffey KP, etal., Biochemistry 1987 Dec 1;26(24):7900-4.
4.
Measurement of rat heart fatty acid binding protein by ELISA. Tissue distribution, developmental changes and subcellular distribution.
Crisman TS, etal., J Mol Cell Cardiol. 1987 May;19(5):423-31.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Purification and characterization of fatty-acid-binding proteins from rat heart and liver.
Glatz JF, etal., Biochim Biophys Acta. 1985 Oct 23;837(1):57-66.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
Role of portal region lysine residues in electrostatic interactions between heart fatty acid binding protein and phospholipid membranes.
Herr FM, etal., Biochemistry. 1996 Jan 30;35(4):1296-303.
9.
Analysis of the tissue-specific expression, developmental regulation, and linkage relationships of a rodent gene encoding heart fatty acid binding protein.
Heuckeroth RO, etal., J Biol Chem 1987 Jul 15;262(20):9709-17.
10.
Mechanism of free fatty acid transfer from rat heart fatty acid-binding protein to phospholipid membranes. Evidence for a collisional process.
Kim HK and Storch J, J Biol Chem. 1992 Oct 5;267(28):20051-6.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
Characterization of a fatty acid-binding protein from rat heart.
Offner GD, etal., J Biol Chem. 1986 Apr 25;261(12):5584-9.
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
Fatty acid-dependent expression of the muscle FABP gene - comparative analysis of gene control in functionally related, but evolutionary distant animal systems.
Qu H, etal., Mol Cell Biochem. 2007 May;299(1-2):45-53.
16.
GOA pipeline
RGD automated data pipeline
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Equilibrium constants for the binding of fatty acids with fatty acid-binding proteins from adipocyte, intestine, heart, and liver measured with the fluorescent probe ADIFAB.
Richieri GV, etal., J Biol Chem. 1994 Sep 30;269(39):23918-30.
19.
Molecular mechanisms of diabetes reversibility after bariatric surgery.
Rosa G, etal., Int J Obes (Lond). 2007 Sep;31(9):1429-36. Epub 2007 May 22.
20.
Rat heart fatty acid-binding protein is highly homologous to the murine adipocyte 422 protein and the P2 protein of peripheral nerve myelin.
Sacchettini JC, etal., J Biol Chem. 1986 Jun 25;261(18):8218-23.
21.
Fatty acid binding protein from rat heart. The fatty acid binding proteins from rat heart and liver are different proteins.
Said B and Schulz H, J Biol Chem. 1984 Jan 25;259(2):1155-9.
22.
Tissue-specific suppression of aortic fatty-acid-binding protein in streptozotocin-induced diabetic rats.
Sakai K, etal., Eur J Biochem. 1995 Apr 1;229(1):201-6.
23.
Partial gene deletion of heart-type fatty acid-binding protein limits the severity of dietary-induced insulin resistance.
Shearer J, etal., Diabetes. 2005 Nov;54(11):3133-9.
24.
Polymorphisms in fatty acid-binding protein-3 (FABP3) - putative association with type 2 diabetes mellitus.
Shin HD, etal., Hum Mutat. 2003 Aug;22(2):180.
25.
Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.
Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35
26.
Association between fatty acid binding protein 3 gene variants and essential hypertension in humans.
Ueno T, etal., Am J Hypertens. 2008 Jun;21(6):691-5. Epub 2008 Apr 10.
27.
Immunohistochemical distribution of heart-type fatty acid-binding protein immunoreactivity in normal human tissues and in acute myocardial infarct.
Watanabe K, etal., J Pathol. 1993 May;170(1):59-65.
28.
Immunohistochemical studies on the localisation and ontogeny of heart fatty acid binding protein in the rat.
Watanabe M, etal., J Anat. 1991 Feb;174:81-95.
29.
Binding of cytochrome P450 monooxygenase and lipoxygenase pathway products by heart fatty acid-binding protein.
Widstrom RL, etal., Biochemistry. 2001 Jan 30;40(4):1070-6.
30.
Serum adiponectin as a biomarker for in vivo PPARgamma activation and PPARgamma agonist-induced efficacy on insulin sensitization/lipid lowering in rats.
Yang B, etal., BMC Pharmacol. 2004 Oct 18;4:23.
31.
Structure and chromosomal location of the rat gene encoding the heart fatty acid-binding protein.
Zhang J, etal., Eur J Biochem 1999 Dec;266(2):347-51.
Fabp3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,936,027 - 147,942,870 (+) NCBI GRCr8 mRatBN7.2 5 142,651,962 - 142,658,707 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 142,651,956 - 142,658,718 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 145,351,237 - 145,357,980 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 147,121,043 - 147,127,786 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 147,118,434 - 147,125,177 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 148,528,854 - 148,535,597 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 148,528,725 - 148,535,565 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 152,246,250 - 152,252,993 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 149,340,525 - 149,347,268 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 149,350,578 - 149,357,307 (+) NCBI Celera 5 141,118,398 - 141,125,141 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
FABP3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 31,359,588 - 31,373,076 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 31,365,253 - 31,376,850 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 31,838,100 - 31,845,923 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 31,610,687 - 31,618,510 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 31,507,593 - 31,514,985 NCBI Celera 1 30,094,670 - 30,102,486 (-) NCBI Celera Cytogenetic Map 1 p35.2 NCBI HuRef 1 29,944,876 - 29,952,692 (-) NCBI HuRef CHM1_1 1 31,954,007 - 31,961,831 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 31,211,868 - 31,225,340 (-) NCBI T2T-CHM13v2.0
Fabp3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 130,202,531 - 130,209,256 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 130,202,388 - 130,209,256 (+) Ensembl GRCm39 Ensembl GRCm38 4 130,308,738 - 130,315,463 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 130,308,595 - 130,315,463 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 129,986,022 - 129,992,707 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 129,811,082 - 129,817,767 (+) NCBI MGSCv36 mm8 Celera 4 128,641,729 - 128,648,414 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 63.43 NCBI
Fabp3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 9,846,689 - 9,861,971 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 9,851,182 - 9,858,735 (-) NCBI ChiLan1.0 ChiLan1.0
FABP3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 195,456,558 - 195,473,533 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 194,579,251 - 194,592,583 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 30,640,595 - 30,653,450 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 31,660,924 - 31,673,689 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 31,665,270 - 31,673,689 (-) Ensembl panpan1.1 panPan2
FABP3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 69,651,140 - 69,659,082 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 69,650,322 - 69,658,443 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 66,229,601 - 66,237,545 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 70,215,389 - 70,223,333 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 70,214,573 - 70,226,198 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 67,051,318 - 67,059,262 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 68,048,008 - 68,055,952 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 69,047,575 - 69,055,518 (+) NCBI UU_Cfam_GSD_1.0
Fabp3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 48,751,795 - 48,760,226 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 14,574,891 - 14,585,706 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 14,576,582 - 14,584,362 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FABP3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 87,942,790 - 87,951,610 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 87,943,003 - 87,950,708 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 81,714,138 - 81,715,645 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FABP3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 101,464,899 - 101,472,223 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 101,464,960 - 101,474,350 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 15,202,100 - 15,209,969 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fabp3
.
Predicted Target Of
Count of predictions: 143 Count of miRNA genes: 98 Interacting mature miRNAs: 106 Transcripts: ENSRNOT00000017325 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH129910
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 142,651,053 - 142,651,259 (+) MAPPER mRatBN7.2 Rnor_6.0 5 148,527,946 - 148,528,151 NCBI Rnor6.0 Rnor_5.0 5 152,245,342 - 152,245,547 UniSTS Rnor5.0 RGSC_v3.4 5 149,339,617 - 149,339,822 UniSTS RGSC3.4 Celera 5 141,117,490 - 141,117,695 UniSTS Cytogenetic Map 5 q36 UniSTS
RH134427
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 142,658,732 - 142,658,918 (+) MAPPER mRatBN7.2 Rnor_6.0 5 148,535,625 - 148,535,810 NCBI Rnor6.0 Rnor_5.0 5 152,253,021 - 152,253,206 UniSTS Rnor5.0 RGSC_v3.4 5 149,347,296 - 149,347,481 UniSTS RGSC3.4 Celera 5 141,125,169 - 141,125,354 UniSTS RH 3.4 Map 5 990.09 UniSTS Cytogenetic Map 5 q36 UniSTS
RH94406
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 142,658,522 - 142,658,702 (+) MAPPER mRatBN7.2 mRatBN7.2 5 15,110,318 - 15,110,494 (+) MAPPER mRatBN7.2 Rnor_6.0 5 14,994,377 - 14,994,552 NCBI Rnor6.0 Rnor_6.0 5 148,535,415 - 148,535,594 NCBI Rnor6.0 Rnor_5.0 5 19,778,456 - 19,778,631 UniSTS Rnor5.0 Rnor_5.0 5 152,252,811 - 152,252,990 UniSTS Rnor5.0 RGSC_v3.4 5 149,347,086 - 149,347,265 UniSTS RGSC3.4 RGSC_v3.4 5 15,336,448 - 15,336,623 UniSTS RGSC3.4 Celera 5 14,492,133 - 14,492,308 UniSTS Celera 5 141,124,959 - 141,125,138 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017325 ⟹ ENSRNOP00000017325
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 142,651,956 - 142,658,718 (+) Ensembl Rnor_6.0 Ensembl 5 148,528,725 - 148,535,565 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109377 ⟹ ENSRNOP00000084646
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 142,651,956 - 142,657,944 (+) Ensembl
RefSeq Acc Id:
NM_024162 ⟹ NP_077076
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,936,125 - 147,942,868 (+) NCBI mRatBN7.2 5 142,651,962 - 142,658,705 (+) NCBI Rnor_6.0 5 148,528,854 - 148,535,597 (+) NCBI Rnor_5.0 5 152,246,250 - 152,252,993 (+) NCBI RGSC_v3.4 5 149,340,525 - 149,347,268 (+) RGD Celera 5 141,118,398 - 141,125,141 (+) RGD
Sequence:
CTCACGACCGACATCGACCTCCTTTCTCATTGCACCATGGCGGACGCCTTTGTCGGTACCTGGAAGCTAGTGGACAGCAAGAATTTTGATGACTACATGAAGTCACTCGGTGTGGGCTTTGCCACCAG
hide sequence
RefSeq Acc Id:
XM_063288462 ⟹ XP_063144532
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,936,027 - 147,942,870 (+) NCBI
RefSeq Acc Id:
NP_077076 ⟸ NM_024162
- UniProtKB:
Q9QY04 (UniProtKB/Swiss-Prot), P07483 (UniProtKB/Swiss-Prot), A6ISN9 (UniProtKB/TrEMBL)
- Sequence:
MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRT
hide sequence
Ensembl Acc Id:
ENSRNOP00000017325 ⟸ ENSRNOT00000017325
Ensembl Acc Id:
ENSRNOP00000084646 ⟸ ENSRNOT00000109377
RefSeq Acc Id:
XP_063144532 ⟸ XM_063288462
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A2E9 (UniProtKB/TrEMBL)
RGD ID: 13694082 Promoter ID: EPDNEW_R4607 Type: single initiation site Name: Fabp3_1 Description: fatty acid binding protein 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 148,528,850 - 148,528,910 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-27
Fabp3
fatty acid binding protein 3
Fabp3
fatty acid binding protein 3, muscle and heart
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
Fabp3
fatty acid binding protein 3, muscle and heart
Fabp3
fatty acid binding protein 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Fabp3
fatty acid binding protein 3
Name updated
70584 APPROVED
